BYKdb

Annotate results for A0A0T6VYB2

A0A0T6VYB2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0T6VYB2
DOMAINtad21/197DFIDLKKIWHAVWSRKWGIVLLVAVVAVLTAVLLSRMTPIYKAVASVIIEVKGTPVVSFQ
PANAPTEVSEYLQTQLSLIQSRGVAEKVVRDLELTEHPEFDLRQQPGPLINIGGMLDAIM
GEEPEPLTEAQIMDHATQVFMDRTTVWVEGKSQLVYLSVAMADKLMAAQAANHLATS
DOMAINcd541/729TSTAPGEGKSSVSANLAFAMGQLNRVLLIDADLRRATLDQTFEFAPGTPGLANLIGGNAK
LDDCIRSVGNVDMISAGTVPSNPLELLSSPRFAKLLEAVKGRYDRIIIDSPPSQAVSDAA
VLSILADAVIYVIKSESTLIPHAQKGVAQLLQSNAPVAGVVLNHVDVEKAKRNGQFRGYY
DHYGYSEQT
SITEWalker A548/550GKS
SITEWalker A'567/574LLIDADLR
SITEWalker B646/652IIIDSPP
SITEY Cluster719/725YYDHYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSPVRPDRPWQRSTSTDDSDFIDLKKIWHAVWSRKWGIVLLVAVVAVLTAVLLSRMTPIYKAVASVIIEVKGTPVVSFQ
                    DFIDLKKIWHAVWSRKWGIVLLVAVVAVLTAVLLSRMTPIYKAVASVIIEVKGTPVVSFQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PANAPTEVSEYLQTQLSLIQSRGVAEKVVRDLELTEHPEFDLRQQPGPLINIGGMLDAIMGEEPEPLTEAQIMDHATQVF
PANAPTEVSEYLQTQLSLIQSRGVAEKVVRDLELTEHPEFDLRQQPGPLINIGGMLDAIMGEEPEPLTEAQIMDHATQVF

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDRTTVWVEGKSQLVYLSVAMADKLMAAQAANHLATSYIEAQLEAKVEMSMTAASWMNTRLVDLRQNLKDSEDRLQAYLD
MDRTTVWVEGKSQLVYLSVAMADKLMAAQAANHLATS                                           

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEGLVDMDGVGTISANELSLTGDRMIDARRQRAEAESQFRQVESMRDQGWERLASVPAVLGHPLIQQFKADRAHARSRVE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLSRRYGDRHPAMQSARSDLNAATASLRQQVEQVVASIERSYQLAVANENSLRASFNDNKEQIQDISRKEFKVRDLQREV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EANRALYDTFMTRLQETTATSDLSSTNARIVDEAIPPAQASEPNTRLFMVVALFLALVVGIAQAIIREILDNTFKSSDEV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ETKLNLPVMGIVPQVPRNLRKQVSHLFQRNEEKRFCEAIRTIRTNITLTEGNQPRQVLVVTSTAPGEGKSSVSANLAFAM
                                                            TSTAPGEGKSSVSANLAFAM
                                                                   GKS          
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GQLNRVLLIDADLRRATLDQTFEFAPGTPGLANLIGGNAKLDDCIRSVGNVDMISAGTVPSNPLELLSSPRFAKLLEAVK
GQLNRVLLIDADLRRATLDQTFEFAPGTPGLANLIGGNAKLDDCIRSVGNVDMISAGTVPSNPLELLSSPRFAKLLEAVK
      LLIDADLR                                                                  
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRYDRIIIDSPPSQAVSDAAVLSILADAVIYVIKSESTLIPHAQKGVAQLLQSNAPVAGVVLNHVDVEKAKRNGQFRGYY
GRYDRIIIDSPPSQAVSDAAVLSILADAVIYVIKSESTLIPHAQKGVAQLLQSNAPVAGVVLNHVDVEKAKRNGQFRGYY
     IIIDSPP                                                                  YY
       730
....:....|
DHYGYSEQTV
DHYGYSEQT 
DHYGY     

© 1998-2019