BYKdb

Annotate results for A0A0T6ZE69

A0A0T6ZE69 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0T6ZE69
DOMAINtad17/162ALLDVREIIDFLRRRWRFISCTAALTLAVFVAISLAITPSYTAFSRILLDAPKDYILSQD
AGPELRDNSTFIESEIAVLTSASLLQKVVESEGLAEEDPDLSAGALAWLEGALEVSRVGL
ADVIELSVTSHDPEEAARLANALAEV
DOMAINcd509/696TSALPGEGKTTLALSLAYSAAADGERALVIDADLRVSATTAFFGMAENVGLVDLLTLPID
PAKAIHLDERSGIHVLPAGGKTLNPPALLASARMRAMLEEFRRTYDTVIIDAPPVGPVAD
ASILAGHADRVVFVVKWRDTAREAVAEGIRYLGNRSKISGIALTMVDGPKLPKYGRYASL
DGKGYDNR
SITE-588/-590GKT
SITEWalker A'536/543LVIDADLR
SITEWalker B616/622VIIDAPP
SITEY Cluster682/697YGRYASLDGKGYDNRY
SITEWalker A516/518GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKMQSSTDRVIVTPEPALLDVREIIDFLRRRWRFISCTAALTLAVFVAISLAITPSYTAFSRILLDAPKDYILSQDAGPE
                ALLDVREIIDFLRRRWRFISCTAALTLAVFVAISLAITPSYTAFSRILLDAPKDYILSQDAGPE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRDNSTFIESEIAVLTSASLLQKVVESEGLAEEDPDLSAGALAWLEGALEVSRVGLADVIELSVTSHDPEEAARLANALA
LRDNSTFIESEIAVLTSASLLQKVVESEGLAEEDPDLSAGALAWLEGALEVSRVGLADVIELSVTSHDPEEAARLANALA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVYVQDRIASRYEGAKKASTWLSERAGILREELSHSENAVQKFRAEHNLLATQSGSLTEQQLSELNIALINARAELATKR
EV                                                                              

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SKFEQAEKILRIGGDAQTLPDVLQSNVVSALRTQAGVMARKEADLRLRYGEQHPEVMTVQAERRDIEQQISAETQRLIGN


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRNEVEAAEAREAALSRALASVSGQSAVEDQVGVQLRDLERIAAANKELFQTFLSRAKIAEEKSTLLSSGVRVITHAGVP


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LAPSFPNRPLFAAVGLVFGAALGGAGALVRELFASGFMARRQVEEALAFPVLASLPRMTEWSRTKSRVQPVAYLEHRPLS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYSEAIRRLRLGLGGISEADHSRSITLVTSALPGEGKTTLALSLAYSAAADGERALVIDADLRVSATTAFFGMAENVGLV
                            TSALPGEGKTTLALSLAYSAAADGERALVIDADLRVSATTAFFGMAENVGLV
                                   GKT                 LVIDADLR                 
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLLTLPIDPAKAIHLDERSGIHVLPAGGKTLNPPALLASARMRAMLEEFRRTYDTVIIDAPPVGPVADASILAGHADRVV
DLLTLPIDPAKAIHLDERSGIHVLPAGGKTLNPPALLASARMRAMLEEFRRTYDTVIIDAPPVGPVADASILAGHADRVV
                                                       VIIDAPP                  
       650       660       670       680       690         
....:....|....:....|....:....|....:....|....:....|....:....
FVVKWRDTAREAVAEGIRYLGNRSKISGIALTMVDGPKLPKYGRYASLDGKGYDNRYLN
FVVKWRDTAREAVAEGIRYLGNRSKISGIALTMVDGPKLPKYGRYASLDGKGYDNR   
                                         YGRYASLDGKGYDNRY  
© 1998-2019