BYKdb

Annotate results for A0A0T7BPJ4

A0A0T7BPJ4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0T7BPJ4
DOMAINtad1/148MAKGISSLVAVLKRRGLPAAAAFVAVMGAAGAYLLLSPKLYEASARMMLDDKRVSVSDLG
RDLTQVTSTTPGGPSPLADQAELVKSEKVLEKAIAATYPPGVKDSITPEKLRKKLKVKIV
PATNILEFKYEARDAQLAAKLLNVIAQT
DOMAINcd515/702SSTISGEGKSVVASHLGAVSAMLSRKTLIIDADLRRPEQHRIFHLEHKPGVADVIAGNLS
LMEAVQPSGTENLSVLTCGEMHNRPSQLLESPEMKALIAEATAKFDLVIIDTPPLCACAD
ASTLSRYSDGMVVVTRPGFTLKEILQKAVVDLTHNGVKVLGIVVNGMTSDTDLYYRYPVT
GYQPKLTP
SITEWalker A522/524GKS
SITEWalker A'542/549LIIDADLR
SITEWalker B622/628VIIDTPP
SITEY Cluster688/696YYRYPVTGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAKGISSLVAVLKRRGLPAAAAFVAVMGAAGAYLLLSPKLYEASARMMLDDKRVSVSDLGRDLTQVTSTTPGGPSPLADQ
MAKGISSLVAVLKRRGLPAAAAFVAVMGAAGAYLLLSPKLYEASARMMLDDKRVSVSDLGRDLTQVTSTTPGGPSPLADQ

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AELVKSEKVLEKAIAATYPPGVKDSITPEKLRKKLKVKIVPATNILEFKYEARDAQLAAKLLNVIAQTMVEENTRTISSQ
AELVKSEKVLEKAIAATYPPGVKDSITPEKLRKKLKVKIVPATNILEFKYEARDAQLAAKLLNVIAQT            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATKVREFLEKKEVPAAQRNLTVAEANENRQKQASGIVSFDEQSKSVVTSLASLEDQERTALAQLQELRSRAASLEKITKT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSLDKAYSAVRTGQDEEVKKLRSKLTELEQQVIQAKLKFTEEHPTVTKLVQERDAVKAMYEQEVARVSPDGQSQTTNFAS


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DDLTKDLTAQLITNQTESLAVQKKLRVIQAERANLQARLGKLPLQQQSVAALTRKREEAAESLKTLQRKLEEARIAEAQK


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VSNLSIIEFAKPGTSPSSPKIPVVLVVATVFGTVLATGIILLLEAMDNTLRSGWEAQDLLKLQLLGVLPRLPGSTLKLQS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADTFLDDIGSVEPYRMLLKNIEFRNLEDLNSIVISSTISGEGKSVVASHLGAVSAMLSRKTLIIDADLRRPEQHRIFHLE
                                  SSTISGEGKSVVASHLGAVSAMLSRKTLIIDADLRRPEQHRIFHLE
                                         GKS                 LIIDADLR           
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKPGVADVIAGNLSLMEAVQPSGTENLSVLTCGEMHNRPSQLLESPEMKALIAEATAKFDLVIIDTPPLCACADASTLSR
HKPGVADVIAGNLSLMEAVQPSGTENLSVLTCGEMHNRPSQLLESPEMKALIAEATAKFDLVIIDTPPLCACADASTLSR
                                                             VIIDTPP            
       650       660       670       680       690       700       710       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
YSDGMVVVTRPGFTLKEILQKAVVDLTHNGVKVLGIVVNGMTSDTDLYYRYPVTGYQPKLTPTNKSFTALSGGKNSK
YSDGMVVVTRPGFTLKEILQKAVVDLTHNGVKVLGIVVNGMTSDTDLYYRYPVTGYQPKLTP               
                                               YYRYPVTGY                     

© 1998-2019