BYKdb

Annotate results for A0A0T7BUI3

A0A0T7BUI3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0T7BUI3
DOMAINtad8/154EELDIQQYFLVLQRRWKILLALIITSVGFSGFAILRQKPQYQATGMLLFKSDRISSLTKA
GEKIGDLESLIRENNPLNTQAVIVNSQPVIKEVIKTLNLKDNQGKFRNPETLLIKVEPIV
GTDVLKVSHASDNPKLAAKIVNQVMAT
DOMAINcd532/720TSCVPGEGKSEVSANLAAILAQAGRRVLLIDADMRKPSQHHLWGLINSVGLSNVIVGQND
FPQAVQRITSNLFVLTAGVQPPNPLGLIDSEGMTELIRNFAQDYDYILFDTPPLAGTADA
AVLGKILDGVLLVTRPGVVDSVSATAAKSLLERSGANILGMIANGVNLKQEPDSYFYYSK
PRWGQSTSE
SITEWalker A539/541GKS
SITEWalker A'559/566LLIDADMR
SITEWalker B638/644ILFDTPP
SITE-635/-637YDY
SITEY Cluster706/709YFYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MEKQKALEELDIQQYFLVLQRRWKILLALIITSVGFSGFAILRQKPQYQATGMLLFKSDRISSLTKAGEKIGDLESLIRE
       EELDIQQYFLVLQRRWKILLALIITSVGFSGFAILRQKPQYQATGMLLFKSDRISSLTKAGEKIGDLESLIRE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NNPLNTQAVIVNSQPVIKEVIKTLNLKDNQGKFRNPETLLIKVEPIVGTDVLKVSHASDNPKLAAKIVNQVMATYAENNV
NNPLNTQAVIVNSQPVIKEVIKTLNLKDNQGKFRNPETLLIKVEPIVGTDVLKVSHASDNPKLAAKIVNQVMAT      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ESNRTQVTAAGEFIKKQLPSSRKELESAAEALRQFKNKNKIVQLEQESSSAITSMAKLDEEINQATANLAETLAQESQVG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NQIKTVKNQAIEITSLNQIPGVQEVLSELQKTQSRLALERVKYTNNHPNVVYLENQEKTLKSLLNRRTQEITGNQLEVSL


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SNLQVGKIREDLANQYVQLKTKRQGLQKKIAALQGVQQIYQKRLNAIPNLEKKQSDLERKLSVAKLNHENLNARLQEIQV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AEKQTIGNAKIIQPAQIPETPMLSKKSLMLALGSLFAGSLLGIAGAFFVDLIDRSLKTVKEAENFFGWTLLGLIPRFEAN


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKSVAANITDDGISERVIVNSSPRTIIHEAYQMLQANLNFISHKKVRAIAITSCVPGEGKSEVSANLAAILAQAGRRVLL
                                                   TSCVPGEGKSEVSANLAAILAQAGRRVLL
                                                          GKS                 LL
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDADMRKPSQHHLWGLINSVGLSNVIVGQNDFPQAVQRITSNLFVLTAGVQPPNPLGLIDSEGMTELIRNFAQDYDYILF
IDADMRKPSQHHLWGLINSVGLSNVIVGQNDFPQAVQRITSNLFVLTAGVQPPNPLGLIDSEGMTELIRNFAQDYDYILF
IDADMR                                                                       ILF
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTPPLAGTADAAVLGKILDGVLLVTRPGVVDSVSATAAKSLLERSGANILGMIANGVNLKQEPDSYFYYSKPRWGQSTSE
DTPPLAGTADAAVLGKILDGVLLVTRPGVVDSVSATAAKSLLERSGANILGMIANGVNLKQEPDSYFYYSKPRWGQSTSE
DTPP                                                             YFYY           
       730 
....:....|.
TDTKDEQWIYK


© 1998-2019