BYKdb

Annotate results for A0A0T7FM59

A0A0T7FM59 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0T7FM59
DOMAINtad21/204TFIDLDKLWAAAIRRSGVIVVCLIATVALAGLYLVMAQPVYTALTQILIDENLSRYADDP
QDSQSAQQIDNRMSSAVEILKSKALAVRVVDKAKLDQNETVVNPPQSPVDLAKGAIRSVV
ALLTPGSPPASEENIRMGRREKAAAVLQQSLTVERVGRSSVIALSVRSPDPQLAAMITRT
YAES
DOMAINcd575/766VSCLPGEGKSMVAANFAGLIASTGVRTLVIDADLRNPGLSRMLASEPEVGLVEVVLQQTP
WTNAARVDRRSRLTILPMTTRSKQLAHTSELLASSGMSHFLESIKDTFDVIVVDLAPLLP
VIDAKAFEPYVDGFVFVTEWGVTPAKAVQSIIRSEPQIASKTVGVILNKTEMSELHRYAD
PGSPERLHSSYV
SITEWalker A582/584GKS
SITEWalker A'602/609LVIDADLR
SITEWalker B685/691IVVDLAP
SITEY Cluster765/769YVSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDQVNFRPRTIFPSETRDNDTFIDLDKLWAAAIRRSGVIVVCLIATVALAGLYLVMAQPVYTALTQILIDENLSRYADDP
                    TFIDLDKLWAAAIRRSGVIVVCLIATVALAGLYLVMAQPVYTALTQILIDENLSRYADDP

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QDSQSAQQIDNRMSSAVEILKSKALAVRVVDKAKLDQNETVVNPPQSPVDLAKGAIRSVVALLTPGSPPASEENIRMGRR
QDSQSAQQIDNRMSSAVEILKSKALAVRVVDKAKLDQNETVVNPPQSPVDLAKGAIRSVVALLTPGSPPASEENIRMGRR

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EKAAAVLQQSLTVERVGRSSVIALSVRSPDPQLAAMITRTYAESYLTEQLNANFDATERASLWLQERLNDLNSRSQQASL
EKAAAVLQQSLTVERVGRSSVIALSVRSPDPQLAAMITRTYAES                                    

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVEQYKTQHGLVSPRGELLSTQQLSDLNSQLIVAQADAATASARYNQYQAIIAKGPDAAVQNAVVSARDTDNSVIQDLRK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYINISDREQGIIQQFGANHPQAIALKADKSDLSQQIYRELQQLTGSFRNEFEVASSREKSLRDSIERVAGRNSEANVSM


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VQLRELEQKAAALKTLYESYLGRFEEATQRQSFPIAKARVISDAGLPTAPSSPRKTLTMALSVVLGLLIGGATATLLEFR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ERFFRTGDDVQEKLGLRFLGYLPMVSGASAEETPPPATTDAEAAGAPPGNPISFRRLMRVAVEAPRSQFAETLRNAKLAC


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DIMLQDRKCRVIGVVSCLPGEGKSMVAANFAGLIASTGVRTLVIDADLRNPGLSRMLASEPEVGLVEVVLQQTPWTNAAR
              VSCLPGEGKSMVAANFAGLIASTGVRTLVIDADLRNPGLSRMLASEPEVGLVEVVLQQTPWTNAAR
                     GKS                 LVIDADLR                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDRRSRLTILPMTTRSKQLAHTSELLASSGMSHFLESIKDTFDVIVVDLAPLLPVIDAKAFEPYVDGFVFVTEWGVTPAK
VDRRSRLTILPMTTRSKQLAHTSELLASSGMSHFLESIKDTFDVIVVDLAPLLPVIDAKAFEPYVDGFVFVTEWGVTPAK
                                            IVVDLAP                             
       730       740       750       760       770        
....:....|....:....|....:....|....:....|....:....|....:...
AVQSIIRSEPQIASKTVGVILNKTEMSELHRYADPGSPERLHSSYVSYYKEGSASAPR
AVQSIIRSEPQIASKTVGVILNKTEMSELHRYADPGSPERLHSSYV            
                                            YVSYY         

© 1998-2019