BYKdb

Annotate results for A0A0T8AXE3

A0A0T8AXE3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0T8AXE3
DOMAINcd41/227TSVNPGEGKTTTSVNIARSFARTGYKTLLIDGDTRNSVISGVFKSREKITGLTEFLSETA
DLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
DAAIITQKCDASILVTAIGEVNKRDVQKAKQQLEQTEKLFLGVVLNKLDISVDKYGLYGS
YGNYRKE
SITEWalker A48/50GKT
SITEWalker A'68/75LLIDGDTR
SITEWalker B149/155IIVDTPP
SITE-145/-148YFDY
SITEY Cluster215/224YGLYGSYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPTLEIAQKKLEFIKKAEEYYNALCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARTGYKTLLIDGDTRNSVIS
                                        TSVNPGEGKTTTSVNIARSFARTGYKTLLIDGDTRNSVIS
                                               GKT                 LLIDGDTR     
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GVFKSREKITGLTEFLSETADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
GVFKSREKITGLTEFLSETADLSHGLCDTNIENLFVIQSGSVSPNPTALLQSKNFNDMIETLRKYFDYIIVDTPPIGIVI
                                                                    IIVDTPP     
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
DAAIITQKCDASILVTAIGEVNKRDVQKAKQQLEQTEKLFLGVVLNKLDISVDKYGLYGSYGNYRKE
DAAIITQKCDASILVTAIGEVNKRDVQKAKQQLEQTEKLFLGVVLNKLDISVDKYGLYGSYGNYRKE
                                                      YGLYGSYGNY   
© 1998-2019