BYKdb

Annotate results for A0A0T8Y3R6

A0A0T8Y3R6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0T8Y3R6
DOMAINcd18/204TSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVISGVFKSREKITGLTEFLSGTA
DLSYGLCDTNIENLFVVQSGSVSPNPIALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVI
DAVIITQKCDASILVTATGEANKRDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYAS
YGNYGKK
SITEWalker A25/27GKT
SITEWalker A'45/52LLIDGDTR
SITEWalker B126/132IIVDTPP
SITE-122/-125YFDY
SITEY Cluster192/201YGVYASYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MCTNIQLSGDKLKVISVTSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVISGVFKSREKITGLTEFLSGTADLS
                 TSVNPGEGKTTTSVNIARSFARAGYKTLLIDGDTRNSVISGVFKSREKITGLTEFLSGTADLS
                        GKT                 LLIDGDTR                            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YGLCDTNIENLFVVQSGSVSPNPIALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAVIITQKCDASILVTATGEANK
YGLCDTNIENLFVVQSGSVSPNPIALLQSKNFNDMIETLRKYFDYIIVDTPPVGIVIDAVIITQKCDASILVTATGEANK
                                             IIVDTPP                            
       170       180       190       200    
....:....|....:....|....:....|....:....|....
RDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
RDVQKAKQQLEQTGKLFLGVVLNKLDISVDKYGVYASYGNYGKK
                               YGVYASYGNY   
© 1998-2019