BYKdb

Annotate results for A0A0T9WDP2

A0A0T9WDP2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0T9WDP2
DOMAINtad176/412DEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQD
INSALANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEM
VKVTTFTRPETMSGQIFTLKVLGDKRYQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDAR
PDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRDQIRDILNSITRN
DOMAINcd694/881TGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGE
IASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTD
AAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYY
EYEYQSDS
SITEWalker A701/703GKT
SITEWalker A'721/728LLIDCDMR
SITEWalker B801/807VLIDTPP
SITEY Cluster867/877YQDYGYYEYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNKILVVCVGNVCRSPTAERLLKRFHPSLTVASAGLGALVGKGADPAAASVASAHDLSLENHCARQISARLCREYDLIL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMEKRHIAALCDIAPEMRGKVMLFGHWDSEREIPDPYRKSRDAFEAVYTLLERSXXXXXXXXXXXVCPPVGAGTECRAGK


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TMTEKVKQSAAATGSDEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSAL
               DEIDIGRLVGTVIEARWWVLGTTAIFALCAVIYTFFATPIYSADALVQIEQNAGNSLVQDINSAL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDK
ANKPPASDAEIQLIRSRLVLGKTVDDLDLDIAVTKNTFPLFGAGWERLMGRHNEMVKVTTFTRPETMSGQIFTLKVLGDK

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRD
RYQLVSDGGFSAQGVVGQPLNKDGVTMRVEAIDARPDTEFTVSKFSTLGMINNLQNNLTVTETGKDTGVLSLTFTGEDRD

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QIRDILNSITRNYLQQDIARKSEEAGKSLAFLAKQLPEVRSRLDVAXXXNKLNAFRQDKDSVDLPLEAKAVLDSMVNIDA
QIRDILNSITRN                                                                    

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLNELTFKEAEISKLFTKAHPAYRTLLEKRKALEDEKAKLNGRVTAMPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKI


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVLLRSLFNRGIESPQALEEHGISVYASIPLSEWQKA


       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQAQNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRV
                                                     TGVSPSIGKTFVCANLAAVISQTHKRV
                                                            GKT                 
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDL
LLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDL
LLIDCDMR                                                                        
       810       820       830       840       850       860       870       880
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSD
VLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSD
VLIDTPP                                                           YQDYGYYEYEY   
  
..
SK
S 

© 1998-2019