BYKdb

Annotate results for A0A0T9WT26

A0A0T9WT26 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0T9WT26
DOMAINcd168/355TGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGE
IASCAKPTAIANFDLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTD
AAIVGRHAGTTLMVARYAVNTLKEVETSLSRFDQNGIQVKGVILNSIFRRATGYQDYGYY
EYEYQSDS
SITEWalker A175/177GKT
SITEWalker A'195/202LLIDCDMR
SITEWalker B275/281VLIDTPP
SITEY Cluster341/351YQDYGYYEYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPKTQQEIVRLTRDVESGQQVYMQLLNKQQELKITEASTVGDVRIVDPAITQPGVLKPKKALIILGSIILGLMLSIVGVL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LRSLFNRGIESPQALEEHGISVYASIPLSEWQKARDSVKTIKGIKRYKQSQLLAVGNPTDLAIEAIRSLRTSLHFAMMQA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QNNVLMLTGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANF
       TGVSPSIGKTFVCANLAAVISQTHKRVLLIDCDMRKGYTHELLGTNNVDGLSDILAGKGEIASCAKPTAIANF
              GKT                 LLIDCDMR                                      
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFD
DLIPRGQVPPNPSELLMSERFGELIAWASSRYDLVLIDTPPILAVTDAAIVGRHAGTTLMVARYAVNTLKEVETSLSRFD
                                  VLIDTPP                                       
       330       340       350      
....:....|....:....|....:....|....:.
QNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDSK
QNGIQVKGVILNSIFRRATGYQDYGYYEYEYQSDS 
                    YQDYGYYEYEY     
© 1998-2019