BYKdb

Annotate results for A0A0U0CYW6

A0A0U0CYW6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U0CYW6
DOMAINcd50/229TSAGPEEGKSTTAANLAVVFAQQGKKVLLIDADLRKPTVHFTFKLDNGTGLTSLLLKQLP
FQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAATVYDKVILDTPPVLAVAD
TKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
SITE-187/-189GKT
SITEWalker A'77/84LLIDADLR
SITEWalker B157/163VILDTPP
SITEY Cluster224/227YAYY
SITEWalker A57/59GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLTRKKDKPGKRSVIAMSEPKSINSEQYRTIRTNIEFSSVDTEVKSLLITSAGPEEGKSTTAANLAVVFAQQGKKVLLID
                                                 TSAGPEEGKSTTAANLAVVFAQQGKKVLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRKPTVHFTFKLDNGTGLTSLLLKQLPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAATVYDKVILD
ADLRKPTVHFTFKLDNGTGLTSLLLKQLPFQKAVLPADEANLDILTSGPIPPNPAELLSTGAMKDLLSEAATVYDKVILD
ADLR                                                                        VILD
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
TPPVLAVADTKILGSYTDGAIMVISSGKTDKEKAAKAKEALDYCPCKLLGAVMNGKKQTKHSDYAYYGQ
TPP                                                            YAYY  
© 1998-2019