BYKdb

Annotate results for A0A0U0IPK3

A0A0U0IPK3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U0IPK3
DOMAINcd62/252SSALPSEGKSTVNANLAVVYAQQGKKVLLVDADLRRPTVAATFGDDRTTVGLTNYLSDNK
KEISDVIKTSGIPNLDIITSGPIPPNPAELLGSGIMTELIDKLKSVYDLVIFDVPPFLMV
TDAQVLLSKVDGVAIVVNGGKSNKSDLKRTYEILQLSEVPLLGFIYNDKNNKKNSGYGYG
YGYGYGTTADK
SITE-201/-203GKS
SITEWalker A'89/96LLVDADLR
SITEWalker B171/177VIFDVPP
SITEY Cluster238/246YGYGYGYGY
SITEWalker A69/71GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSFFRNRTDKKNRLLTDTMTNGARLIAAAELKNPVVEQFRTIRTNIDFASVAKGDIKTLLISSALPSEGKSTVNANLAVV
                                                             SSALPSEGKSTVNANLAVV
                                                                    GKS         
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YAQQGKKVLLVDADLRRPTVAATFGDDRTTVGLTNYLSDNKKEISDVIKTSGIPNLDIITSGPIPPNPAELLGSGIMTEL
YAQQGKKVLLVDADLRRPTVAATFGDDRTTVGLTNYLSDNKKEISDVIKTSGIPNLDIITSGPIPPNPAELLGSGIMTEL
        LLVDADLR                                                                
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDKLKSVYDLVIFDVPPFLMVTDAQVLLSKVDGVAIVVNGGKSNKSDLKRTYEILQLSEVPLLGFIYNDKNNKKNSGYGY
IDKLKSVYDLVIFDVPPFLMVTDAQVLLSKVDGVAIVVNGGKSNKSDLKRTYEILQLSEVPLLGFIYNDKNNKKNSGYGY
          VIFDVPP                                                            YGY
       250  
....:....|..
GYGYGYGTTADK
GYGYGYGTTADK
GYGYGY      
© 1998-2019