BYKdb

Annotate results for A0A0U0XQN3

A0A0U0XQN3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U0XQN3
DOMAINcd56/248TSANISEGKSTVTANVAITYAQAGRKTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEAD
AINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVKSHYDMVIIDLAPVLE
VSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYG
YGYGYGYGYGAEK
SITEWalker A63/65GKS
SITEWalker A'83/90LLIDADLR
SITEWalker B166/172VIIDLAP
SITEY Cluster232/244YGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MALFRKKRGTDDTIKHGAKLITVADPRSAVSEQFRTIRTNINFMAVDEEISTLAFTSANISEGKSTVTANVAITYAQAGR
                                                       TSANISEGKSTVTANVAITYAQAGR
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADAINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
KTLLIDADLRRPTLHSTFNVKNNTGLTTVLTSEADAINLNDVVEESGIDNLSILTSGPIPPNPAELIGSRRMETFIELVK
  LLIDADLR                                                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
SHYDMVIIDLAPVLEVSDTQELASHLDGVVLVVRQGVTQKAGITRAVQMLKFAKARILGYVMNDIRAENGGYGYGYGYGY
     VIIDLAP                                                           YGYGYGYGY
       250       260 
....:....|....:....|.
GYGYGAEKKKGLFGRKKSDDQ
GYGYGAEK             
GYGY                 
© 1998-2019