BYKdb

Annotate results for A0A0U1KJQ7

A0A0U1KJQ7 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U1KJQ7
DOMAINcd52/233TSSGPSEGKSSTVANLAIVFAQQGKKVLLIDGDMRKPTVHYTFRIDNRRGLSSVLVSEAT
LEESIEKSDVADLDILTCGPIPPNPSELLGSKAMGKLMEQACEYYDIVLFDTPPVLAVTD
AQILANSCDGSILVLRSKQTDYEAAQKARDLLQPANAKLIGAVLNDRDMKKGNSYYYYYG
NH
SITEWalker A59/61GKS
SITEWalker A'79/86LLIDGDMR
SITEWalker B159/165VLFDTPP
SITE-155/-156YY
SITEY Cluster226/230YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MARRKKQAKNTAIRHLIAKLNPKSPISEQYRTIRTNLQFSSVDGEMKKILVTSSGPSEGKSSTVANLAIVFAQQGKKVLL
                                                   TSSGPSEGKSSTVANLAIVFAQQGKKVLL
                                                          GKS                 LL
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IDGDMRKPTVHYTFRIDNRRGLSSVLVSEATLEESIEKSDVADLDILTCGPIPPNPSELLGSKAMGKLMEQACEYYDIVL
IDGDMRKPTVHYTFRIDNRRGLSSVLVSEATLEESIEKSDVADLDILTCGPIPPNPSELLGSKAMGKLMEQACEYYDIVL
IDGDMR                                                                        VL
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
FDTPPVLAVTDAQILANSCDGSILVLRSKQTDYEAAQKARDLLQPANAKLIGAVLNDRDMKKGNSYYYYYGNH
FDTPPVLAVTDAQILANSCDGSILVLRSKQTDYEAAQKARDLLQPANAKLIGAVLNDRDMKKGNSYYYYYGNH
FDTPP                                                            YYYYY   
© 1998-2019