BYKdb

Annotate results for A0A0U1KTG0

A0A0U1KTG0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U1KTG0
DOMAINcd43/230TSAGPGEGKSTTTANTAVAIAQTGKRVIIVDCDLRKPVQHKIFGKRNRGVTNILVEELTV
KDLVQDTDIDNLKILTSGPIPPNPSELLGSYKMQEVIAALQEVADIVIIDAPPTVAVTDA
CVLASKVDGIVLVLDSKAIRPEMAQKAKENLLKANGCILGVILNRVEIEEEHAYYYYYYG
DQKKIEKI
SITEWalker A50/52GKS
SITEWalker A'70/77IIVDCDLR
SITEWalker B149/155VIIDAPP
SITEY Cluster216/221YYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTQQRKLIVHEDAKSPIAEAYRTLRTNIQFARVDSDLRTIMFTSAGPGEGKSTTTANTAVAIAQTGKRVIIVDCDLRKPV
                                          TSAGPGEGKSTTTANTAVAIAQTGKRVIIVDCDLRKPV
                                                 GKS                 IIVDCDLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHKIFGKRNRGVTNILVEELTVKDLVQDTDIDNLKILTSGPIPPNPSELLGSYKMQEVIAALQEVADIVIIDAPPTVAVT
QHKIFGKRNRGVTNILVEELTVKDLVQDTDIDNLKILTSGPIPPNPSELLGSYKMQEVIAALQEVADIVIIDAPPTVAVT
                                                                    VIIDAPP     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DACVLASKVDGIVLVLDSKAIRPEMAQKAKENLLKANGCILGVILNRVEIEEEHAYYYYYYGDQKKIEKIRFGYILMRRK
DACVLASKVDGIVLVLDSKAIRPEMAQKAKENLLKANGCILGVILNRVEIEEEHAYYYYYYGDQKKIEKI          
                                                       YYYYYY                   
      
....:.
FGSTCS


© 1998-2019