BYKdb

Annotate results for A0A0U1L4W2

A0A0U1L4W2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U1L4W2
DOMAINcd43/231TSAGAGEGKSVTVANTAVVLAQTGKKVILMDCDLRKPVQHEIFKKRKTNRGLTNVLNGEC
SISDIVQDTGIPNLQLITSGSIRFNPSELLDSDKFKETISSLKSQADYIIIDSPPVLPVT
DACILGSKVDGIILVVGVGKVQPEMALKAKEHMEIVNGNILGIIINHYENFVEQSAYYHY
CENVEKAAN
SITEWalker A50/52GKS
SITEWalker A'70/77ILMDCDLR
SITEWalker B151/157IIIDSPP
SITEY Cluster219/222YYHY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMNDRTLIVNHSPKSIWAEAFRAFRTKILHSKKGSIVKSILVTSAGAGEGKSVTVANTAVVLAQTGKKVILMDCDLRKPV
                                          TSAGAGEGKSVTVANTAVVLAQTGKKVILMDCDLRKPV
                                                 GKS                 ILMDCDLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QHEIFKKRKTNRGLTNVLNGECSISDIVQDTGIPNLQLITSGSIRFNPSELLDSDKFKETISSLKSQADYIIIDSPPVLP
QHEIFKKRKTNRGLTNVLNGECSISDIVQDTGIPNLQLITSGSIRFNPSELLDSDKFKETISSLKSQADYIIIDSPPVLP
                                                                      IIIDSPP   
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
VTDACILGSKVDGIILVVGVGKVQPEMALKAKEHMEIVNGNILGIIINHYENFVEQSAYYHYCENVEKAAN
VTDACILGSKVDGIILVVGVGKVQPEMALKAKEHMEIVNGNILGIIINHYENFVEQSAYYHYCENVEKAAN
                                                          YYHY         
© 1998-2019