BYKdb

Annotate results for A0A0U1NQ42

A0A0U1NQ42 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U1NQ42
DOMAINcd52/232TSSGPGEGKSTTAANLAVVFAQLGKKVLIVDADLRKPTVHHTFGINTHIGFSTVLTKQAD
LTSAIVKTEEKDLYVLPSGPIPPNPSELLSSKSMEQFIADVKTVFDYIIFDTPPLLAVAD
PQILANQCDGAILVVYSEKTVREHAVKGKEMLENVKSKLLGVVLNHKELQKNDYYYYYGN
K
SITEWalker A59/61GKS
SITEWalker A'79/86LIVDADLR
SITEWalker B159/165IIFDTPP
SITEY Cluster225/229YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLKKKTTKTSSRRKLVTILDPKSPIAEQYRTVRTNIQFSSVDQELKTIMVTSSGPGEGKSTTAANLAVVFAQLGKKVLI
                                                   TSSGPGEGKSTTAANLAVVFAQLGKKVLI
                                                          GKS                 LI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDADLRKPTVHHTFGINTHIGFSTVLTKQADLTSAIVKTEEKDLYVLPSGPIPPNPSELLSSKSMEQFIADVKTVFDYII
VDADLRKPTVHHTFGINTHIGFSTVLTKQADLTSAIVKTEEKDLYVLPSGPIPPNPSELLSSKSMEQFIADVKTVFDYII
VDADLR                                                                        II
       170       180       190       200       210       220       230  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
FDTPPLLAVADPQILANQCDGAILVVYSEKTVREHAVKGKEMLENVKSKLLGVVLNHKELQKNDYYYYYGNK
FDTPPLLAVADPQILANQCDGAILVVYSEKTVREHAVKGKEMLENVKSKLLGVVLNHKELQKNDYYYYYGNK
FDTPP                                                           YYYYY   
© 1998-2019