BYKdb

Annotate results for A0A0U2ILF9

A0A0U2ILF9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U2ILF9
DOMAINcd46/231TSPEPSEGKSTTITNLAVAFAQEGKKVVLVDADLRKPTLHHFFMKSNRIGLSNLLAGQFT
LQQAISDTHIDNLSLICSGPVPPNPAEMLNSKRLEQQLEELKKMFDIILFDAPPTLAVTD
AQVLSTKCDGVVFVLNSGKVKRDTARKAIDRLNHVNAKILGVVLNNKDRNKNESPYYYYY
GPNDKK
SITEWalker A53/55GKS
SITEWalker A'73/80VLVDADLR
SITEWalker B153/159ILFDAPP
SITEY Cluster221/225YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MPTSTRNYNIITDVNPKSYISEAYRTLRTNIQFSTIDNHIRSIIVTSPEPSEGKSTTITNLAVAFAQEGKKVVLVDADLR
                                             TSPEPSEGKSTTITNLAVAFAQEGKKVVLVDADLR
                                                    GKS                 VLVDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTLHHFFMKSNRIGLSNLLAGQFTLQQAISDTHIDNLSLICSGPVPPNPAEMLNSKRLEQQLEELKKMFDIILFDAPPT
KPTLHHFFMKSNRIGLSNLLAGQFTLQQAISDTHIDNLSLICSGPVPPNPAEMLNSKRLEQQLEELKKMFDIILFDAPPT
                                                                        ILFDAPP 
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
LAVTDAQVLSTKCDGVVFVLNSGKVKRDTARKAIDRLNHVNAKILGVVLNNKDRNKNESPYYYYYGPNDKK
LAVTDAQVLSTKCDGVVFVLNSGKVKRDTARKAIDRLNHVNAKILGVVLNNKDRNKNESPYYYYYGPNDKK
                                                            YYYYY      
© 1998-2019