BYKdb

Annotate results for A0A0U2N9T6

A0A0U2N9T6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U2N9T6
DOMAINcd51/231TSAAKEEGKSTTAANMAIVFAETGKKVLLIDADMRRPTLYRTFQLGNNTGLSNLLLRKGS
LKQSVKVSGIANLDLLMSGQIPPNPAELLEADALDELIAEMRETYDYILFDSPPILSVTD
SKILANRCDGTVLVVNTGKSEKISVEKARDSLATAKALILGVVLNNYPMNKENYYYHNYN
E
SITE-188/-190GKS
SITEWalker A'78/85LLIDADMR
SITEWalker B158/164ILFDSPP
SITE-155/-157YDY
SITEY Cluster224/229YYYHNY
SITEWalker A58/60GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRTANKTKRLMPRKLVARTNPHSIAAEQYRTIRTNINFSTPDLHSRVILFTSAAKEEGKSTTAANMAIVFAETGKKVLLI
                                                  TSAAKEEGKSTTAANMAIVFAETGKKVLLI
                                                         GKS                 LLI
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DADMRRPTLYRTFQLGNNTGLSNLLLRKGSLKQSVKVSGIANLDLLMSGQIPPNPAELLEADALDELIAEMRETYDYILF
DADMRRPTLYRTFQLGNNTGLSNLLLRKGSLKQSVKVSGIANLDLLMSGQIPPNPAELLEADALDELIAEMRETYDYILF
DADMR                                                                        ILF
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DSPPILSVTDSKILANRCDGTVLVVNTGKSEKISVEKARDSLATAKALILGVVLNNYPMNKENYYYHNYNE
DSPPILSVTDSKILANRCDGTVLVVNTGKSEKISVEKARDSLATAKALILGVVLNNYPMNKENYYYHNYNE
DSPP                                                           YYYHNY  
© 1998-2019