BYKdb

Annotate results for A0A0U2UUZ5

A0A0U2UUZ5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U2UUZ5
DOMAINcd46/227ASAQSGEGKTTTISNLAVTYAHEGKNVLLIDADLRKPTLHNVFVTSNRVGLSNLIAGQCA
LPEVTVETRINHLSVIPSGPVPPNPSELLGSQRMRAIMKDIRSRYDIILLDTPPVLAVPD
SLIVSSLSDGVIMVVQAGKVKSDMVRKAKAGLEHAKARILGVVLNRIKRNENAQFIRYYG
SK
SITEWalker A53/55GKT
SITEWalker A'73/80LLIDADLR
SITEWalker B153/159ILLDTPP
SITEY Cluster223/224YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRQNSEANLVTFVNPNSPISEAYRTLRTNIQFSSIDHPVQVIMCASAQSGEGKTTTISNLAVTYAHEGKNVLLIDADLR
                                             ASAQSGEGKTTTISNLAVTYAHEGKNVLLIDADLR
                                                    GKT                 LLIDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KPTLHNVFVTSNRVGLSNLIAGQCALPEVTVETRINHLSVIPSGPVPPNPSELLGSQRMRAIMKDIRSRYDIILLDTPPV
KPTLHNVFVTSNRVGLSNLIAGQCALPEVTVETRINHLSVIPSGPVPPNPSELLGSQRMRAIMKDIRSRYDIILLDTPPV
                                                                        ILLDTPP 
       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
LAVPDSLIVSSLSDGVIMVVQAGKVKSDMVRKAKAGLEHAKARILGVVLNRIKRNENAQFIRYYGSK
LAVPDSLIVSSLSDGVIMVVQAGKVKSDMVRKAKAGLEHAKARILGVVLNRIKRNENAQFIRYYGSK
                                                              YY   
© 1998-2019