BYKdb

Annotate results for A0A0U2VAW2

A0A0U2VAW2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U2VAW2
DOMAINcd202/390SGPSPGVGKSFISVNLAVVLAQSGKKVLIVDADMRKGYLQTQFNIEAAEGLSDYLSGRLN
LRQVTKATKVEGLSVITRGQIPPNPSELLMHSNFSKFIAELSTAYDLVIIDTPPILAVTD
PAIVSAHAGTTLLVTRFGQNHLREIELTRNRFEQNGIDIKGVVFNGVLKKASNAYGYYGY
YNYEYKSDA
SITEWalker A209/211GKS
SITEWalker A'229/236LIVDADMR
SITEWalker B309/315VIIDTPP
SITEY Cluster376/386YGYYGYYNYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLTDWHYPTYQGLVEQIAAVKEQRKALVGEVGNLPETQQELLRLKRDVEVSNQIYTLLLGKTQELDIVRAGTVGNVRIID


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
YAEVNTSKPVKPKKALIVVMATMLGGMLGVAIVLVQKAMHKGVEDPSEIEALGIPVYASVPHSEHQDKLAGFNKGRKSKA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AKAKSILATDNPADLAVEALRSLRTSLHFAMMEAKNNVIAISGPSPGVGKSFISVNLAVVLAQSGKKVLIVDADMRKGYL
                                         SGPSPGVGKSFISVNLAVVLAQSGKKVLIVDADMRKGYL
                                                GKS                 LIVDADMR    
       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QTQFNIEAAEGLSDYLSGRLNLRQVTKATKVEGLSVITRGQIPPNPSELLMHSNFSKFIAELSTAYDLVIIDTPPILAVT
QTQFNIEAAEGLSDYLSGRLNLRQVTKATKVEGLSVITRGQIPPNPSELLMHSNFSKFIAELSTAYDLVIIDTPPILAVT
                                                                    VIIDTPP     
       330       340       350       360       370       380       390
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DPAIVSAHAGTTLLVTRFGQNHLREIELTRNRFEQNGIDIKGVVFNGVLKKASNAYGYYGYYNYEYKSDA
DPAIVSAHAGTTLLVTRFGQNHLREIELTRNRFEQNGIDIKGVVFNGVLKKASNAYGYYGYYNYEYKSDA
                                                       YGYYGYYNYEY    
© 1998-2019