BYKdb

Annotate results for A0A0U2WGK5

A0A0U2WGK5 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U2WGK5
DOMAINcd46/229TSASPREGKTTTVNNLAVAYAQTGKSVLLVDADLRRPTAHHTFQTSNRCGLTHILTGQAK
VADAVQNTSINGLKLLSSGSIPPNPSELLGSDKMDRLLAELRESYDIVLIDTPPVLAVSD
AQVVATRCDGVLLVVNAKSVKRRYVIKAKEALEFVHARVLGVALNQVPSSEANPYYEYSQ
EVRS
SITE-69/-71GKS
SITEWalker A'73/80LLVDADLR
SITEWalker B153/159VLIDTPP
SITEY Cluster220/223YYEY
SITEWalker A53/55GKT
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSRSHEARPLITDVNPLSPISEAYRTLRTNLQYAEVDRPLRLLMVTSASPREGKTTTVNNLAVAYAQTGKSVLLVDADLR
                                             TSASPREGKTTTVNNLAVAYAQTGKSVLLVDADLR
                                                    GKT                 LLVDADLR
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RPTAHHTFQTSNRCGLTHILTGQAKVADAVQNTSINGLKLLSSGSIPPNPSELLGSDKMDRLLAELRESYDIVLIDTPPV
RPTAHHTFQTSNRCGLTHILTGQAKVADAVQNTSINGLKLLSSGSIPPNPSELLGSDKMDRLLAELRESYDIVLIDTPPV
                                                                        VLIDTPP 
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
LAVSDAQVVATRCDGVLLVVNAKSVKRRYVIKAKEALEFVHARVLGVALNQVPSSEANPYYEYSQEVRS
LAVSDAQVVATRCDGVLLVVNAKSVKRRYVIKAKEALEFVHARVLGVALNQVPSSEANPYYEYSQEVRS
                                                           YYEY      
© 1998-2019