BYKdb

Annotate results for A0A0U3JVM7

A0A0U3JVM7 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0U3JVM7
DOMAINtad39/281PGLDIATLVLVARRSLLWMLLLVGLGVTASWLYLRYTKPVYKSASLLKIDERNEGSALGL
AGQAAAPAVMDKGRTKLAGEVELIKSNIIYRRLKDSLALDINYYVQGTVLESELYGIAPF
RVKYHITDPSLYNHKFDLKFVGPQRFALEFTGQGRPLGGEYSLGQEIKLPGITLAVLGTN
ELTNAAQDASYHFTILDDRTVNEYLDKNLTVEIVNPEASTIQISFNDFNPSKAQDIVNKI
DSV
DOMAINcd623/812TSTISGEGKTFVTVNLGGIIALSGQRVIILDLDMRKPKVNLAFGAENVKGVSTILIERHS
IQECIQPTSIESMQFISAGPTPPNPSELILSDKFDQMIQELFQSYDVILIDTPPVGLVTD
GILIMRKADIPLYIVRADYSRKAFIKNMNRLMRSNNFTRMCTILNDANSRGSGYGYGYGY
GYGYGYGAYG
SITEWalker A630/632GKT
SITEWalker A'650/657IILDLDMR
SITEWalker B730/736ILIDTPP
SITE-755/-761YIVRADY
SITEY Cluster796/816YGYGYGYGYGYGYGAYGQGYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAINENTELEELIRNATGGTASPPEAPSASGGDADDDAPGLDIATLVLVARRSLLWMLLLVGLGVTASWLYLRYTKPVYK
                                      PGLDIATLVLVARRSLLWMLLLVGLGVTASWLYLRYTKPVYK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SASLLKIDERNEGSALGLAGQAAAPAVMDKGRTKLAGEVELIKSNIIYRRLKDSLALDINYYVQGTVLESELYGIAPFRV
SASLLKIDERNEGSALGLAGQAAAPAVMDKGRTKLAGEVELIKSNIIYRRLKDSLALDINYYVQGTVLESELYGIAPFRV

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KYHITDPSLYNHKFDLKFVGPQRFALEFTGQGRPLGGEYSLGQEIKLPGITLAVLGTNELTNAAQDASYHFTILDDRTVN
KYHITDPSLYNHKFDLKFVGPQRFALEFTGQGRPLGGEYSLGQEIKLPGITLAVLGTNELTNAAQDASYHFTILDDRTVN

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EYLDKNLTVEIVNPEASTIQISFNDFNPSKAQDIVNKIDSVYLAEKLAQKSETTTRKLRFLDQILDQNGQNLERAEDRLQ
EYLDKNLTVEIVNPEASTIQISFNDFNPSKAQDIVNKIDSV                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NFVQQTGTYDSKGEFSAITEKLEKLEADRLKLTDKINMLGEIAQMASQGSLTRDETQTVEQSIPALAGIEDPQLAQQLNE


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LNDLQWQLRRASRSYTDKTEAIQSKQANIEYTRASIKRLLQQNQKLLRNELSRLDQQRSKLTGALQSLPAKSTQLERLKR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLDLYVTSYLQLMDRKVQFNIEKAGATADFQILSPASPPAAPISPNRLIVYAIGLAGGLFMGLGLIAVRYFMHNTVSNVR


       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELERNTKASVLGIIPTYDKEKMEVSRLVVDKNPKSAISESIRSIRTNLDFISSAKKKRLISVTSTISGEGKTFVTVNLGG
                                                              TSTISGEGKTFVTVNLGG
                                                                     GKT        
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IIALSGQRVIILDLDMRKPKVNLAFGAENVKGVSTILIERHSIQECIQPTSIESMQFISAGPTPPNPSELILSDKFDQMI
IIALSGQRVIILDLDMRKPKVNLAFGAENVKGVSTILIERHSIQECIQPTSIESMQFISAGPTPPNPSELILSDKFDQMI
         IILDLDMR                                                               
       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QELFQSYDVILIDTPPVGLVTDGILIMRKADIPLYIVRADYSRKAFIKNMNRLMRSNNFTRMCTILNDANSRGSGYGYGY
QELFQSYDVILIDTPPVGLVTDGILIMRKADIPLYIVRADYSRKAFIKNMNRLMRSNNFTRMCTILNDANSRGSGYGYGY
         ILIDTPP                                                           YGYGY
       810       820       830     
....:....|....:....|....:....|....:
GYGYGYGYGAYGQGYYEEPETKALTFGEKIKKFFN
GYGYGYGYGAYG                       
GYGYGYGYGAYGQGYY                   

© 1998-2019