BYKdb

Annotate results for A0A0U3NLF2

A0A0U3NLF2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U3NLF2
DOMAINcd57/246TSAESGAGKSTIASNLALSFVSQGMKVLLIDADMRKPVIHNLFKLTNRDGLTTLLSTKGL
DEDRVIHKIGSSNLSVLTCGPVPPNPSELMASKRMQQLMNDLKKRFDLIIVDVPPIIAVA
DAQIMANMADGTIFVIRKGISTKDSVMKAKELLEMSKATIIGSVFNGTVENEDMNSSYYG
VEKKGHHDSF
SITEWalker A64/66GKS
SITEWalker A'84/91LLIDADMR
SITEWalker B165/171IIVDVPP
SITEY Cluster234/235YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLAFLKGKHTRTVKQGNPSELEMVTHPASRISEQYRTLRANIQFSSVDNVLKTFVVTSAESGAGKSTIASNLALSFVSQG
                                                        TSAESGAGKSTIASNLALSFVSQG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKVLLIDADMRKPVIHNLFKLTNRDGLTTLLSTKGLDEDRVIHKIGSSNLSVLTCGPVPPNPSELMASKRMQQLMNDLKK
MKVLLIDADMRKPVIHNLFKLTNRDGLTTLLSTKGLDEDRVIHKIGSSNLSVLTCGPVPPNPSELMASKRMQQLMNDLKK
   LLIDADMR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RFDLIIVDVPPIIAVADAQIMANMADGTIFVIRKGISTKDSVMKAKELLEMSKATIIGSVFNGTVENEDMNSSYYGVEKK
RFDLIIVDVPPIIAVADAQIMANMADGTIFVIRKGISTKDSVMKAKELLEMSKATIIGSVFNGTVENEDMNSSYYGVEKK
    IIVDVPP                                                              YY     
       
....:..
GHHDSFY
GHHDSF 

© 1998-2019