BYKdb

Annotate results for A0A0U3U526

A0A0U3U526 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U3U526
DOMAINcd1/186KIGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMLGVFKARDKITGLTEFLSGTTDLS
QGLCDTNIENLFVIQAGSVSPNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAA
IITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGVVLNKFDTSVDKYGSYGNYGD
YGKNKK
SITEWalker A5/7GKS
SITEWalker A'25/32LLIDGDIR
SITEWalker B106/112IIVDTAP
SITE-102/-105YFDY
SITEY Cluster172/181YGSYGNYGDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KIGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMLGVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVS
KIGEGKSTTSTNIAWAFARAGYKTLLIDGDIRNSVMLGVFKARDKITGLTEFLSGTTDLSQGLCDTNIENLFVIQAGSVS
    GKS                 LLIDGDIR                                                
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGV
PNPTALLQSKNFSTMLETLRKYFDYIIVDTAPVGVVIDAAIITRKCDASILVTEAGEINRRDIQKAKEQLEHTGKPFLGV
                         IIVDTAP                                                
       170       180      
....:....|....:....|....:.
VLNKFDTSVDKYGSYGNYGDYGKNKK
VLNKFDTSVDKYGSYGNYGDYGKNKK
           YGSYGNYGDY     
© 1998-2019