BYKdb

Annotate results for A0A0U3XWM6

A0A0U3XWM6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0U3XWM6
DOMAINtad6/142TGWSLGSAWAAIRKFWYVIIGMAVIGGAVAYGISSTTTPQFQSTATLYFAMNQGTTGTDL
NQGSTYTQSQMLSFAQLATSSRVLAPVIDDLGLDSTPKELTRNIAITIPQDTTILSVEVT
STSAKRAAEIANAISEE
DOMAINcd274/458TSASPAEGKSTFSANLAVTLADLGERTLLIDADLRRPRAGEIFGLDSSVGLTSVVLGSVD
LSEAVVPWRASGPNLLLSGEVPPNSASVLTSHAFADVLDEAGEGNDVVVIDSPPVLTVAD
TNLLAPLADGVVIVVDASKTSRPQLAATIRTLEGAGASIIGIVLNKVRLARGRTTYYTEE
KSGSA
SITEWalker A281/283GKS
SITEWalker A'301/308LLIDADLR
SITEWalker B381/387VVIDSPP
SITEY Cluster449/450YY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKADATGWSLGSAWAAIRKFWYVIIGMAVIGGAVAYGISSTTTPQFQSTATLYFAMNQGTTGTDLNQGSTYTQSQMLSFA
     TGWSLGSAWAAIRKFWYVIIGMAVIGGAVAYGISSTTTPQFQSTATLYFAMNQGTTGTDLNQGSTYTQSQMLSFA

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QLATSSRVLAPVIDDLGLDSTPKELTRNIAITIPQDTTILSVEVTSTSAKRAAEIANAISEELSGAVEEIVAKSVDQKPT
QLATSSRVLAPVIDDLGLDSTPKELTRNIAITIPQDTTILSVEVTSTSAKRAAEIANAISEE                  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IVPSVIDEAVVPQFQSLPNKSRDGALGGVLGLVLGILVAFIATIADTKVRNEAALARVTDLPYLGSITRTKRGTDAGLIT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VREPRSHIAEDFRRVQSALAFANVDGESRRLLITSASPAEGKSTFSANLAVTLADLGERTLLIDADLRRPRAGEIFGLDS
                                 TSASPAEGKSTFSANLAVTLADLGERTLLIDADLRRPRAGEIFGLDS
                                        GKS                 LLIDADLR            
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVGLTSVVLGSVDLSEAVVPWRASGPNLLLSGEVPPNSASVLTSHAFADVLDEAGEGNDVVVIDSPPVLTVADTNLLAPL
SVGLTSVVLGSVDLSEAVVPWRASGPNLLLSGEVPPNSASVLTSHAFADVLDEAGEGNDVVVIDSPPVLTVADTNLLAPL
                                                            VVIDSPP             
       410       420       430       440       450        
....:....|....:....|....:....|....:....|....:....|....:...
ADGVVIVVDASKTSRPQLAATIRTLEGAGASIIGIVLNKVRLARGRTTYYTEEKSGSA
ADGVVIVVDASKTSRPQLAATIRTLEGAGASIIGIVLNKVRLARGRTTYYTEEKSGSA
                                                YY        
© 1998-2019