BYKdb

Annotate results for A0A0U4CFL8

A0A0U4CFL8 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0U4CFL8
DOMAINtad1/253MLIRHAGRIVAVTVTCAALGVGCAFVAKPVYKADIVVQVESGSSDLRSTAEGGLVGGLGA
LFNVMSTDDGEMEIIRSRLVTEPVVDGQHLHIEARPRRVPVIGSIVARFNRGQSAPGLFG
IGGFVWGNERIDVPTFDVPRDFLEHAFIVTTLGHGRYRLSGGDLDRDVEGATGELLRVKT
GAGDVTLQVAGIEAAAGAQFVVKADSKQVVLAELQKQLTIANRGKDQSGVIGVSYESHDP
VRAATVLNAIADN
DOMAINcd530/717TGPSAGVGKSFVSANTAALLGRSGKRVLLIDGDLRRGELATRFGMQPRIGLSSVLRGGVS
AADAIVRDVAPNVDLLPSGPRTDRPVELLSSDRLPALLTQAARDYDVVLVDAPPLLPVTD
AVVLAAHADTILLAARAGVTTSGELLESVKRIERVGVRPTAVVFNGFRPGLRSARYGNYG
AYAYDGAD
SITEWalker A537/539GKS
SITEWalker A'557/564LLIDGDLR
SITEWalker B637/643VLVDAPP
SITEY Cluster705/713YGNYGAYAY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MLIRHAGRIVAVTVTCAALGVGCAFVAKPVYKADIVVQVESGSSDLRSTAEGGLVGGLGALFNVMSTDDGEMEIIRSRLV
MLIRHAGRIVAVTVTCAALGVGCAFVAKPVYKADIVVQVESGSSDLRSTAEGGLVGGLGALFNVMSTDDGEMEIIRSRLV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TEPVVDGQHLHIEARPRRVPVIGSIVARFNRGQSAPGLFGIGGFVWGNERIDVPTFDVPRDFLEHAFIVTTLGHGRYRLS
TEPVVDGQHLHIEARPRRVPVIGSIVARFNRGQSAPGLFGIGGFVWGNERIDVPTFDVPRDFLEHAFIVTTLGHGRYRLS

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GGDLDRDVEGATGELLRVKTGAGDVTLQVAGIEAAAGAQFVVKADSKQVVLAELQKQLTIANRGKDQSGVIGVSYESHDP
GGDLDRDVEGATGELLRVKTGAGDVTLQVAGIEAAAGAQFVVKADSKQVVLAELQKQLTIANRGKDQSGVIGVSYESHDP

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VRAATVLNAIADNYVRQNANRKAATAETSLAFLSDQIPTVERQLRAAEDRLNAYQARHEIVDLTEQAKAMLTQSTAAQTS
VRAATVLNAIADN                                                                   

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LFELEQKRLALASTLTPAHPELAAVDRQIAAAKAQIGTINDTIRRLPDAQQNVVRLRRDATVQTEIYVGLLNSIQQLRVA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TASKIGNVRVIDRAIVPDEPVRPKPVLVAAIAALVGLVLGTCAVIGRAVLFGGVTDPAEIERETNLNVMATIPYSAAQRR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VAQRCAAAGGATVLALARPGEPAVEALQSLCTALRFQLMDRPEGNRVLITGPSAGVGKSFVSANTAALLGRSGKRVLLID
                                                 TGPSAGVGKSFVSANTAALLGRSGKRVLLID
                                                        GKS                 LLID
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GDLRRGELATRFGMQPRIGLSSVLRGGVSAADAIVRDVAPNVDLLPSGPRTDRPVELLSSDRLPALLTQAARDYDVVLVD
GDLRRGELATRFGMQPRIGLSSVLRGGVSAADAIVRDVAPNVDLLPSGPRTDRPVELLSSDRLPALLTQAARDYDVVLVD
GDLR                                                                        VLVD
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
APPLLPVTDAVVLAAHADTILLAARAGVTTSGELLESVKRIERVGVRPTAVVFNGFRPGLRSARYGNYGAYAYDGADVQT
APPLLPVTDAVVLAAHADTILLAARAGVTTSGELLESVKRIERVGVRPTAVVFNGFRPGLRSARYGNYGAYAYDGAD   
APP                                                             YGNYGAYAY       
     
....:
AVDRA


© 1998-2019