BYKdb

Annotate results for A0A0U4P935

A0A0U4P935 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U4P935
DOMAINcd59/245TSSISMEGKSTTTVNLANTYAQTGKKVLIVDADLRKPTLHKTFKLNNNVGLTTALVNDEY
SLESVIQYSEDFDLYLLPSGPIPPNPAELVGSQEFSALLDQITELFDLVIFDTPPLHSVT
DGQIIASKVDGTILVVRQNYVRRDQVVEAKVSLDNVKANLIGYILNDVPVNKNKGYGYYE
YYTEKDS
SITEWalker A66/68GKS
SITEWalker A'86/93LIVDADLR
SITEWalker B167/173VIFDTPP
SITEY Cluster234/240YGYYEYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFNFKSKKKQQKIENEQKLGSPIVTYFEPMSAIAEQYKTIRTNIEFAQIGSSINSIAVTSSISMEGKSTTTVNLANTYAQ
                                                          TSSISMEGKSTTTVNLANTYAQ
                                                                 GKS            
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TGKKVLIVDADLRKPTLHKTFKLNNNVGLTTALVNDEYSLESVIQYSEDFDLYLLPSGPIPPNPAELVGSQEFSALLDQI
TGKKVLIVDADLRKPTLHKTFKLNNNVGLTTALVNDEYSLESVIQYSEDFDLYLLPSGPIPPNPAELVGSQEFSALLDQI
     LIVDADLR                                                                   
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TELFDLVIFDTPPLHSVTDGQIIASKVDGTILVVRQNYVRRDQVVEAKVSLDNVKANLIGYILNDVPVNKNKGYGYYEYY
TELFDLVIFDTPPLHSVTDGQIIASKVDGTILVVRQNYVRRDQVVEAKVSLDNVKANLIGYILNDVPVNKNKGYGYYEYY
      VIFDTPP                                                            YGYYEYY
     
....:
TEKDS
TEKDS

© 1998-2019