BYKdb

Annotate results for A0A0U4VW34

A0A0U4VW34 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U4VW34
DOMAINcd58/248TSSGVWEGKSTVTANTAAVMAQQGLRVLLVDADLRKPTVAKTFNINTTVGLTSLLTDRDA
NIMDTVNYVADANIYILAAGPIPPNPSELLGSNRMAELIGELEEMFDLVIFDTPPILAVT
DAQVVATRVDGVIVVVRSGIANKNEVRKTKDLLDVVNANVIGAVYNGEDANKLGYGYGYG
YGYGYGQSETS
SITEWalker A65/67GKS
SITEWalker A'85/92LLVDADLR
SITEWalker B166/172VIFDTPP
SITEY Cluster232/242YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MFKNKRKHFDKMNAEQRRGASLITVTQPNDVISESFRQIRTNIQFSMVDHDFKSIMFTSSGVWEGKSTVTANTAAVMAQQ
                                                         TSSGVWEGKSTVTANTAAVMAQQ
                                                                GKS             
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLRVLLVDADLRKPTVAKTFNINTTVGLTSLLTDRDANIMDTVNYVADANIYILAAGPIPPNPSELLGSNRMAELIGELE
GLRVLLVDADLRKPTVAKTFNINTTVGLTSLLTDRDANIMDTVNYVADANIYILAAGPIPPNPSELLGSNRMAELIGELE
    LLVDADLR                                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EMFDLVIFDTPPILAVTDAQVVATRVDGVIVVVRSGIANKNEVRKTKDLLDVVNANVIGAVYNGEDANKLGYGYGYGYGY
EMFDLVIFDTPPILAVTDAQVVATRVDGVIVVVRSGIANKNEVRKTKDLLDVVNANVIGAVYNGEDANKLGYGYGYGYGY
     VIFDTPP                                                           YGYGYGYGY
         
....:....
GYGQSETSK
GYGQSETS 
GY       
© 1998-2019