BYKdb

Annotate results for A0A0U5JLQ6

A0A0U5JLQ6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U5JLQ6
DOMAINcd57/247TSANVSEGKSTVTDNVAVVWAQTGQKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTN
SVDLREIIQPSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPMLE
VTDTQILSRHLDAIVLVVKQEQTQKLAIKRAVELLNLAHANLLGYVMNDVNADGDAAYGY
GYGYGYGENTK
SITEWalker A64/66GKS
SITEWalker A'84/91LLIDSDLR
SITEWalker B167/173VIVDVPP
SITEY Cluster234/242YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLFHRTQKQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
                                                        TSANVSEGKSTVTDNVAVVWAQTG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
QKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
   LLIDSDLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQEQTQKLAIKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
KGIYDMVIVDVPPMLEVTDTQILSRHLDAIVLVVKQEQTQKLAIKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGY
      VIVDVPP                                                            YGYGYGY
       
....:..
GYGENTK
GYGENTK
GY     
© 1998-2019