BYKdb

Annotate results for A0A0U5JMM0

A0A0U5JMM0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U5JMM0
DOMAINcd57/248TSANVSEGKSTVTDNVAVVWAQTGQRVLLIDSDLRRPTLHATFSKSNQHGLTTILTSGTN
SVDLREIIQSSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPMLE
VTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAEGDAAYGY
GYGYGYGYEEET
SITEWalker A64/66GKS
SITEWalker A'84/91LLIDSDLR
SITEWalker B167/173VIVDVPP
SITEY Cluster234/244YGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLFHRTQQQSTDTMDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTG
                                                        TSANVSEGKSTVTDNVAVVWAQTG
                                                               GKS              
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRVLLIDSDLRRPTLHATFSKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
QRVLLIDSDLRRPTLHATFSKSNQHGLTTILTSGTNSVDLREIIQSSGVENLDILTAGPIPPNPAELLNSQRMKTLLDTV
   LLIDSDLR                                                                     
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAEGDAAYGYGYGY
KGIYDMVIVDVPPMLEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNAEGDAAYGYGYGY
      VIVDVPP                                                            YGYGYGY
       250
....:....|
GYGYEEETNK
GYGYEEET  
GYGY      
© 1998-2019