BYKdb

Annotate results for A0A0U5JSZ6

A0A0U5JSZ6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U5JSZ6
DOMAINcd40/232TSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAGRYKVDGNTYGLTHYMTGQR
TMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAQLLEEQRDNYDYIIIDAPPLGSVI
DAALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKVDMEHDAYYGNYY
GKYYGKYYGNYGE
SITEWalker A47/49GKT
SITEWalker A'67/74LFVDADIR
SITEWalker B148/154IIIDAPP
SITE-89/-147YGLTHYMTGQRTMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAQLLEEQRDNYDY
SITEY Cluster214/230YYGNYYGKYYGKYYGNY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRKVTFRRKDKLDFKANEAFKTLRSNILFSGKDIKVLTLTSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
                                       TSSTPNEGKTSISFQLASSFAAADNRVLFVDADIRKSVIAG
                                              GKT                 LFVDADIR      
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RYKVDGNTYGLTHYMTGQRTMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAQLLEEQRDNYDYIIIDAPPLGSVID
RYKVDGNTYGLTHYMTGQRTMEEVICQTDIKNMDIILAGPVSPNPTELLGGPLFAQLLEEQRDNYDYIIIDAPPLGSVID
                                                                   IIIDAPP      
       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKVDMEHDAYYGNYYGKYYGKYYGNYGES
AALIARYVDGAIIVVESAVISYKMLQRVKEQLEKSECRILGVVLNKVDMEHDAYYGNYYGKYYGKYYGNYGE 
                                                     YYGNYYGKYYGKYYGNY   
© 1998-2019