BYKdb

Annotate results for A0A0U5KEL8

A0A0U5KEL8 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U5KEL8
DOMAINcd56/247TSAMASAGKSTVSANVAITMAQAGKKTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSM
EMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLKQEYDMVVLDLSPILD
AGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGY
GYGYGYGYGYGY
SITEWalker A63/65GKS
SITEWalker A'83/90ILIDADLR
SITEWalker B166/172VVLDLSP
SITEY Cluster233/247YGYGYGYGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAFGRKKHLDKDTMKNGVKLITLANPQSVISEQFRNIRTNINFMNVDKEVKTIVFTSAMASAGKSTVSANVAITMAQAGK
                                                       TSAMASAGKSTVSANVAITMAQAGK
                                                              GKS               
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
KTILIDADLRRPTMHATFNVSNSNGLTTLLTSRSMEMDANSVIRESGVENLSILTAGPIPPNPSELLSSKHMLDLIEDLK
  ILIDADLR                                                                      
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEYDMVVLDLSPILDAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
QEYDMVVLDLSPILDAGETQQLTSSLDGTILVVRQAHSQKSAVKRAVELLKLTKSPILGYVMNDVDADGDDGYGYGYGYG
     VVLDLSP                                                            YGYGYGYG
       250       260 
....:....|....:....|.
YGYGYGYGEEDEKKGLFGRKK
YGYGYGY              
YGYGYGY              
© 1998-2019