BYKdb

Annotate results for A0A0U5KTX0

A0A0U5KTX0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U5KTX0
DOMAINcd43/234TSANVSEGKSTVTDNVAVVWAQTGQKVLLIDSDLRRPTLHATFNKSNQHGLTTILTSGTN
SVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPMLE
VTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGY
GYGYGYGEDTNN
SITEWalker A50/52GKS
SITEWalker A'70/77LLIDSDLR
SITEWalker B153/159VIVDVPP
SITEY Cluster220/228YGYGYGYGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MDNGAKLITVAHPKSPISEQFRTIRTNINFMAIDKPIKTLAMTSANVSEGKSTVTDNVAVVWAQTGQKVLLIDSDLRRPT
                                          TSANVSEGKSTVTDNVAVVWAQTGQKVLLIDSDLRRPT
                                                 GKS                 LLIDSDLR   
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPM
LHATFNKSNQHGLTTILTSGTNSVDLREIIQPSGVDNLDILTAGPIPPNPAELLNSQRMKTLLDTVKGIYDMVIVDVPPM
                                                                        VIVDVPP 
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGYGYGEDTNNAVCKIK
LEVTDTQILSRHLDAVVLVVKQGQTQKLAVKRAVELLNLAHANLLGYVMNDVNADGDAAYGYGYGYGYGEDTNN      
                                                           YGYGYGYGY            
© 1998-2019