BYKdb

Annotate results for A0A0U5L2D4

A0A0U5L2D4 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0U5L2D4
DOMAINtad1/218MAVTAFFMLMGTLYSLFATPIYNADALVQVESKNANTVLNDLQSMLPDSQPLSATEVEII
NSRMVIGKTVKDLGLDTMIEQEYLPVIGKGLARLMGNKPAQIAISRFDLPRSFEPRAVKV
EVEGPDSYSVSFNGDELFKGKVGQLEQHGDVTMLVSDIKAEEGTSFKVTKLTNLQAIKMI
TSNLSVADKGKDTGVLGLSYTGEDPVLISNVLQSIVEN
DOMAINcd501/690TGASPGIGKTFICSNLAALIAKAGQKVLFIDGDMRRGYTHELLGAENKQGLSSVLSGQTP
FTPALIQRGEYGFDFLPRGQVPPNPSELLMHRRMQELLEWASENYDLVLIDTPPILAVTD
ASIIGKLAGTSLMVARFEGNTTKELDVSYKRFAQNGIEIKGVILNAVVRKASNAYGHGYD
YYDYSYKNAK
SITEWalker A508/510GKT
SITEWalker A'528/535LFIDGDMR
SITEWalker B608/614VLIDTPP
SITEY Cluster675/686YGHGYDYYDYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MAVTAFFMLMGTLYSLFATPIYNADALVQVESKNANTVLNDLQSMLPDSQPLSATEVEIINSRMVIGKTVKDLGLDTMIE
MAVTAFFMLMGTLYSLFATPIYNADALVQVESKNANTVLNDLQSMLPDSQPLSATEVEIINSRMVIGKTVKDLGLDTMIE

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QEYLPVIGKGLARLMGNKPAQIAISRFDLPRSFEPRAVKVEVEGPDSYSVSFNGDELFKGKVGQLEQHGDVTMLVSDIKA
QEYLPVIGKGLARLMGNKPAQIAISRFDLPRSFEPRAVKVEVEGPDSYSVSFNGDELFKGKVGQLEQHGDVTMLVSDIKA

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EEGTSFKVTKLTNLQAIKMITSNLSVADKGKDTGVLGLSYTGEDPVLISNVLQSIVENYLLQNVQRKSEEAQKSLEFLQV
EEGTSFKVTKLTNLQAIKMITSNLSVADKGKDTGVLGLSYTGEDPVLISNVLQSIVEN                      

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QVPAVRAKLDAAEDKLNQYRRQNDSVDMSLEAKAALDSSVSVQTQLNELTFREAEVSQLYTKDHPTYRALLEKRQTLVDE


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QKKLNTRISQMPKTQQEILRLTRDAQSEQEIYVQLLNRQQELNISKASTVGDVRIIDSAETAGMPIAPKKSLIILASLLA


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLVLSVGLVLLKAMFHHGIENPEQLEELGMNVYASVPLSEWQRKKDTEALARGGSKVKADPHNTLLALGNPTDLTIESIR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SLRTSLHFAMMEAKNNILMITGASPGIGKTFICSNLAALIAKAGQKVLFIDGDMRRGYTHELLGAENKQGLSSVLSGQTP
                    TGASPGIGKTFICSNLAALIAKAGQKVLFIDGDMRRGYTHELLGAENKQGLSSVLSGQTP
                           GKT                 LFIDGDMR                         
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FTPALIQRGEYGFDFLPRGQVPPNPSELLMHRRMQELLEWASENYDLVLIDTPPILAVTDASIIGKLAGTSLMVARFEGN
FTPALIQRGEYGFDFLPRGQVPPNPSELLMHRRMQELLEWASENYDLVLIDTPPILAVTDASIIGKLAGTSLMVARFEGN
                                               VLIDTPP                          
       650       660       670       680       690 
....:....|....:....|....:....|....:....|....:....|.
TTKELDVSYKRFAQNGIEIKGVILNAVVRKASNAYGHGYDYYDYSYKNAKS
TTKELDVSYKRFAQNGIEIKGVILNAVVRKASNAYGHGYDYYDYSYKNAK 
                                  YGHGYDYYDYSY     
© 1998-2019