BYKdb

Annotate results for A0A0U5NZQ9

A0A0U5NZQ9 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U5NZQ9
DOMAINcd39/228TSCTPNEGKSTVSLALADSLAEAGKKVLFVDADLRKSVLTGRHKVTGPIKGLSHFLAGQA
KVSDIMYQTQEPGLVVMFAGVVPPNPAELLGQYKFKSLIESAKKVYDYIIIDAPPLGSVI
DSAIIAKQCDASVLVIAANTISYKFARAVKEQLEKSDCPILGVVLNKVDMKQNKYYGKYY
GKYYGEYGKK
SITEWalker A46/48GKS
SITEWalker A'66/73LFVDADLR
SITEWalker B147/153IIIDAPP
SITE-144/-146YDY
SITEY Cluster213/225YYGKYYGKYYGEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MQEIVLRGLKKDYRSNEAYKTLRTNIEFSGEDNKAIVLTSCTPNEGKSTVSLALADSLAEAGKKVLFVDADLRKSVLTGR
                                      TSCTPNEGKSTVSLALADSLAEAGKKVLFVDADLRKSVLTGR
                                             GKS                 LFVDADLR       
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKVTGPIKGLSHFLAGQAKVSDIMYQTQEPGLVVMFAGVVPPNPAELLGQYKFKSLIESAKKVYDYIIIDAPPLGSVIDS
HKVTGPIKGLSHFLAGQAKVSDIMYQTQEPGLVVMFAGVVPPNPAELLGQYKFKSLIESAKKVYDYIIIDAPPLGSVIDS
                                                                  IIIDAPP       
       170       180       190       200       210       220        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
AIIAKQCDASVLVIAANTISYKFARAVKEQLEKSDCPILGVVLNKVDMKQNKYYGKYYGKYYGEYGKK
AIIAKQCDASVLVIAANTISYKFARAVKEQLEKSDCPILGVVLNKVDMKQNKYYGKYYGKYYGEYGKK
                                                    YYGKYYGKYYGEY   
© 1998-2019