BYKdb

Annotate results for A0A0U9HL79

A0A0U9HL79 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0U9HL79
DOMAINcd49/237TSSNPGEGKSFTIANLAMSIAATGSRVLLIDADLRKPRIHKIFLLENYRGLSSILAGDIS
ADFVPQEAGIENLHIITSGPVPPNPAELLGSSKMKQFLNKVSSMYDIVLLDSPPVNSVAD
TSILSTSVDGVILVVEAGSTPREAAILAKQQLEKVKAHILGVVLNKVKQTGSGYYYYYYY
YGESGGHEK
SITEWalker A56/58GKS
SITEWalker A'76/83LLIDADLR
SITEWalker B156/162VLLDSPP
SITEY Cluster222/229YYYYYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKQIQQQLNSNGLMVMDDPKSLVSEAFRLLRTNLQFMGVDKPLKRIVVTSSNPGEGKSFTIANLAMSIAATGSRVLLIDA
                                                TSSNPGEGKSFTIANLAMSIAATGSRVLLIDA
                                                       GKS                 LLIDA
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKPRIHKIFLLENYRGLSSILAGDISADFVPQEAGIENLHIITSGPVPPNPAELLGSSKMKQFLNKVSSMYDIVLLDS
DLRKPRIHKIFLLENYRGLSSILAGDISADFVPQEAGIENLHIITSGPVPPNPAELLGSSKMKQFLNKVSSMYDIVLLDS
DLR                                                                        VLLDS
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PPVNSVADTSILSTSVDGVILVVEAGSTPREAAILAKQQLEKVKAHILGVVLNKVKQTGSGYYYYYYYYGESGGHEKKRK
PPVNSVADTSILSTSVDGVILVVEAGSTPREAAILAKQQLEKVKAHILGVVLNKVKQTGSGYYYYYYYYGESGGHEK   
PP                                                           YYYYYYYY           
    
....
KRRS


© 1998-2019