BYKdb

Annotate results for A0A0V7ZMP6

A0A0V7ZMP6 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0V7ZMP6
DOMAINtad1/145MKKATKIAVRHWKFVLAWNKIILGIAVANIALLPRVWISKSLLILPTSTSNVDADLDNSD
DLKTKEVGFSQQVNPLNVISSIATSDNVLKKVWEQDPQKTSYKQLSEYRGLFDVSPENDS
TVISLSVEGSTPKLATERAQNLIAS
DOMAINcd489/675HLENKSLMIASANSGEGKTTVTLGLANALLELGFRILIVDADFRKCELTQSLGYYGQSIG
DLQLRPINVFENVDLLAMRVPEERIAEFVARGGFEQRLNAIKNSAQYDYILVDSPPVALT
SEAAIIGKIIHNILFVVRTGISSRNCFHDSVEQLKRYRAEVIGLTVNDVDSHNEKYIYSY
NVNQQIQ
SITEWalker A505/507GKT
SITEWalker A'525/532LIVDADFR
SITEWalker B598/604ILVDSPP
SITE-542/-597YYGQSIGDLQLRPINVFENVDLLAMRVPEERIAEFVARGGFEQRLNAIKNSAQYDY
SITEY Cluster664/668YIYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MKKATKIAVRHWKFVLAWNKIILGIAVANIALLPRVWISKSLLILPTSTSNVDADLDNSDDLKTKEVGFSQQVNPLNVIS
MKKATKIAVRHWKFVLAWNKIILGIAVANIALLPRVWISKSLLILPTSTSNVDADLDNSDDLKTKEVGFSQQVNPLNVIS

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SIATSDNVLKKVWEQDPQKTSYKQLSEYRGLFDVSPENDSTVISLSVEGSTPKLATERAQNLIASLKERLQELRQDRVIS
SIATSDNVLKKVWEQDPQKTSYKQLSEYRGLFDVSPENDSTVISLSVEGSTPKLATERAQNLIAS               

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QSEFIQDEVRQAHRKLMDAQKKLNKFKEAGNVISDEHDAKQKVITINALNKSRVEALAEAKAAQAQTRILSARLSLPPQT


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ALKSLQTKGTETSLSIREKLSKVNISLQEAQTYLTDNHPRIENLKFQQEELRNELQEDRVSDNSVSSVAINPNLADRHIV


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKLILAESQAEAMSSKAQQLQIQINYLREQLKKLPTKQGILMDLQRRYDMTKKIYNGLVTQAEKVRLSAFDTYPSFQLLD


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EPFVNNEASSPNIQLIILGAVLISIFGSVAIILLQERRDPLISPKDIQQKNFPVLASVPYMKGLDTSMGEGINEKVEFQR


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LASAISLLHLENKSLMIASANSGEGKTTVTLGLANALLELGFRILIVDADFRKCELTQSLGYYGQSIGDLQLRPINVFEN
        HLENKSLMIASANSGEGKTTVTLGLANALLELGFRILIVDADFRKCELTQSLGYYGQSIGDLQLRPINVFEN
                        GKT                 LIVDADFR                            
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDLLAMRVPEERIAEFVARGGFEQRLNAIKNSAQYDYILVDSPPVALTSEAAIIGKIIHNILFVVRTGISSRNCFHDSVE
VDLLAMRVPEERIAEFVARGGFEQRLNAIKNSAQYDYILVDSPPVALTSEAAIIGKIIHNILFVVRTGISSRNCFHDSVE
                                     ILVDSPP                                    
       650       660       670     
....:....|....:....|....:....|....:
QLKRYRAEVIGLTVNDVDSHNEKYIYSYNVNQQIQ
QLKRYRAEVIGLTVNDVDSHNEKYIYSYNVNQQIQ
                       YIYSY       
© 1998-2019