BYKdb

Annotate results for A0A0V8EXX2

A0A0V8EXX2 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0V8EXX2
DOMAINcd50/231TSAEAGAGKSTTISNLAVTFAQQGKKVLLIDADLRKPSVHMTFRLQNRSGLTNVLTRQIS
VNDAMQGTNFSENLAIISSGPVPPNPSELIGSAAMKNLIDSVTEAFDIVLIDTPPLSAVT
DAQILSRYIGGAVIVVRANQTKKESVTKAKKLLDQVNANILGVVLHGVEASDSAYYYYYG
AE
SITEWalker A57/59GKS
SITEWalker A'77/84LLIDADLR
SITEWalker B158/164VLIDTPP
SITEY Cluster224/228YYYYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSKKNEKLDSNRYLITSVNPKSPISEQYRTIRTTIEFKLADQGLKSFLVTSAEAGAGKSTTISNLAVTFAQQGKKVLLID
                                                 TSAEAGAGKSTTISNLAVTFAQQGKKVLLID
                                                        GKS                 LLID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ADLRKPSVHMTFRLQNRSGLTNVLTRQISVNDAMQGTNFSENLAIISSGPVPPNPSELIGSAAMKNLIDSVTEAFDIVLI
ADLRKPSVHMTFRLQNRSGLTNVLTRQISVNDAMQGTNFSENLAIISSGPVPPNPSELIGSAAMKNLIDSVTEAFDIVLI
ADLR                                                                         VLI
       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
DTPPLSAVTDAQILSRYIGGAVIVVRANQTKKESVTKAKKLLDQVNANILGVVLHGVEASDSAYYYYYGAE
DTPPLSAVTDAQILSRYIGGAVIVVRANQTKKESVTKAKKLLDQVNANILGVVLHGVEASDSAYYYYYGAE
DTPP                                                           YYYYY   
© 1998-2019