BYKdb

Annotate results for A0A0V8J4Y3

A0A0V8J4Y3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0V8J4Y3
DOMAINcd49/229TSSSPGEGKSTTVANLAVVLAQQGKSVLLIDGDLRKPTVHYTFKVSNIQGITNVLTRQIS
LEDAAVQTSVEDLSVLPSGPIPPNPSELLNSKSMEMLVEEAKSKYDYVLFDTPPVLAVTD
AQILANRCDGVVLVTSSGKTEKEAAIKAKELLDNANAKILGVVLNQKEMNENSYYYYYGA
N
SITE-186/-188GKT
SITEWalker A'76/83LLIDGDLR
SITEWalker B156/162VLFDTPP
SITE-153/-155YDY
SITEY Cluster222/226YYYYY
SITEWalker A56/58GKS
SITE-72/-74GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRKTIKDLTQRSLITHNNPKSPISEQYRTIRTNIQFSSIDTHYQSIMVTSSSPGEGKSTTVANLAVVLAQQGKSVLLIDG
                                                TSSSPGEGKSTTVANLAVVLAQQGKSVLLIDG
                                                       GKS                 LLIDG
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DLRKPTVHYTFKVSNIQGITNVLTRQISLEDAAVQTSVEDLSVLPSGPIPPNPSELLNSKSMEMLVEEAKSKYDYVLFDT
DLRKPTVHYTFKVSNIQGITNVLTRQISLEDAAVQTSVEDLSVLPSGPIPPNPSELLNSKSMEMLVEEAKSKYDYVLFDT
DLR                                                                        VLFDT
       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
PPVLAVTDAQILANRCDGVVLVTSSGKTEKEAAIKAKELLDNANAKILGVVLNQKEMNENSYYYYYGAN
PPVLAVTDAQILANRCDGVVLVTSSGKTEKEAAIKAKELLDNANAKILGVVLNQKEMNENSYYYYYGAN
PP                                                           YYYYY   
© 1998-2019