BYKdb

Annotate results for A0A0V8JJ77

A0A0V8JJ77 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0V8JJ77
DOMAINcd54/235TSSGPGEGKSTTAANLAIVYAQQGKRVLLIDADLRKPTAHFSFRLENYVGFTNVLTRKAK
LLDAVHETNIPNLSVLTSGPIPPNPSELLASKNMDALLDEMYETFDFILFDTPPTLAVTD
AQVLANKVEATILVISSGKTEREAAQKAKELLLNAKARLLGVILNNRKIEDGGHYYYYYG
TN
SITE-191/-193GKT
SITEWalker A'81/88LLIDADLR
SITEWalker B161/167ILFDTPP
SITEY Cluster228/232YYYYY
SITEWalker A61/63GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MVRKKQGNDKALTAKRRLVAHTNPKLPIAEQYRTVRSNIQFSNLDEDIRSLVMTSSGPGEGKSTTAANLAIVYAQQGKRV
                                                     TSSGPGEGKSTTAANLAIVYAQQGKRV
                                                            GKS                 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LLIDADLRKPTAHFSFRLENYVGFTNVLTRKAKLLDAVHETNIPNLSVLTSGPIPPNPSELLASKNMDALLDEMYETFDF
LLIDADLRKPTAHFSFRLENYVGFTNVLTRKAKLLDAVHETNIPNLSVLTSGPIPPNPSELLASKNMDALLDEMYETFDF
LLIDADLR                                                                        
       170       180       190       200       210       220       230     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
ILFDTPPTLAVTDAQVLANKVEATILVISSGKTEREAAQKAKELLLNAKARLLGVILNNRKIEDGGHYYYYYGTN
ILFDTPPTLAVTDAQVLANKVEATILVISSGKTEREAAQKAKELLLNAKARLLGVILNNRKIEDGGHYYYYYGTN
ILFDTPP                                                            YYYYY   
© 1998-2019