BYKdb

Annotate results for A0A0V8STB2

A0A0V8STB2 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0V8STB2
DOMAINtad1/135MTLRDVLRSARKHWWWVVLPVVALTLGMGVVSVRSTPVYRSTATLYVALAAGGSAGDLNQ
GSSYTQNQMTSFARLAVLPVTLEPVVRDLGLDTSARQLAKTVAATSPKDSSLLDIAVTGT
SPEQTALVANAVAAQ
DOMAINcd265/452TSALQSEGKSFVATRVAASFAAAGVRTLLVDADLRRPTVAGHVGVDGGAGLTDVLVGRAA
LGDVVQHVGRHLVVLAAGPVPPNPAELLAYPEFGALLDQAAAEFEVVVIDAPPLVPVADA
AVIARRATGVVVVADARQVRRPQLRQVAEAVRLGGGRVVGTVLNREKGLADESYGYVADG
ERRRPRRR
SITEWalker A272/274GKS
SITEWalker A'292/299LLVDADLR
SITEWalker B371/377VVIDAPP
SITEY Cluster438/440YGY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTLRDVLRSARKHWWWVVLPVVALTLGMGVVSVRSTPVYRSTATLYVALAAGGSAGDLNQGSSYTQNQMTSFARLAVLPV
MTLRDVLRSARKHWWWVVLPVVALTLGMGVVSVRSTPVYRSTATLYVALAAGGSAGDLNQGSSYTQNQMTSFARLAVLPV

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TLEPVVRDLGLDTSARQLAKTVAATSPKDSSLLDIAVTGTSPEQTALVANAVAAQLGQVVETLAPKGEAGSTITATVVSE
TLEPVVRDLGLDTSARQLAKTVAATSPKDSSLLDIAVTGTSPEQTALVANAVAAQ                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AVAPAFPIAPNTRRNVLAAFLAGLLIGLAAAWARDALDTRVRHQQDLRRTVDVPVLGSIRQRRRPVKGEAPPSALVGASG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDFRRVRANLEMIGRPGAPKLLVFTSALQSEGKSFVATRVAASFAAAGVRTLLVDADLRRPTVAGHVGVDGGAGLTDVLV
                        TSALQSEGKSFVATRVAASFAAAGVRTLLVDADLRRPTVAGHVGVDGGAGLTDVLV
                               GKS                 LLVDADLR                     
       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GRAALGDVVQHVGRHLVVLAAGPVPPNPAELLAYPEFGALLDQAAAEFEVVVIDAPPLVPVADAAVIARRATGVVVVADA
GRAALGDVVQHVGRHLVVLAAGPVPPNPAELLAYPEFGALLDQAAAEFEVVVIDAPPLVPVADAAVIARRATGVVVVADA
                                                  VVIDAPP                       
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RQVRRPQLRQVAEAVRLGGGRVVGTVLNREKGLADESYGYVADGERRRPRRRRGAPAPSEHAPAPPLDGAAGGADPATAA
RQVRRPQLRQVAEAVRLGGGRVVGTVLNREKGLADESYGYVADGERRRPRRR                            
                                     YGY                                        
       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PRDGRRRAPDGHRAAADAPVRPAVVEDVADDEAASTDVVAAPPAAVAEGVGPRDVASPEDVPRARRADEGRGAATAHPEA


       570       580     
....:....|....:....|....:
DDLDVEHEHEHDEDDAALPSVALRS


© 1998-2019