BYKdb

Annotate results for A0A0W1DI04

A0A0W1DI04 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0W1DI04
DOMAINtad32/199GLPILEQVWSAVLNHRNLALGVIAGCVLLGLVATFLATPQYSSTVRLEILPDAPVATSVE
GQRDKALVNEVSFYNTQYSLLESKSLAERVVRAGNLTADKDFLSAFKLDNPDASMTSAER
QGLTNRATDIILERLAVSPVRNSSLVDVSFSTPSPKLSAKLANLWGQQ
DOMAINcd536/725TSSQPKEGKSNSSLCLATVLAASGKSVILVDADIRNPSQNQYLHIPNSLGLSHYLSGDDN
LEGMISELPKFGFSIITAGKTPPNAAELLGSDRLDTLVAMLLKRFDHVLIDSPPLLGLAD
APLIARRVEGVLFTIEANSTKRRVIGTALSRLQKSGAKLFGAIVTKVGVKNSAYGYGYGY
GYGYSYGDDA
SITE-559/-561GKS
SITEWalker A'563/570ILVDADIR
SITEWalker B643/649VLIDSPP
SITEY Cluster709/721YGYGYGYGYGYSY
SITE-614/-616GKT
SITEWalker A543/545GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNQSINEPASFLPTEQALSVDDGYGEQEARPGLPILEQVWSAVLNHRNLALGVIAGCVLLGLVATFLATPQYSSTVRLEI
                               GLPILEQVWSAVLNHRNLALGVIAGCVLLGLVATFLATPQYSSTVRLEI

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LPDAPVATSVEGQRDKALVNEVSFYNTQYSLLESKSLAERVVRAGNLTADKDFLSAFKLDNPDASMTSAERQGLTNRATD
LPDAPVATSVEGQRDKALVNEVSFYNTQYSLLESKSLAERVVRAGNLTADKDFLSAFKLDNPDASMTSAERQGLTNRATD

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IILERLAVSPVRNSSLVDVSFSTPSPKLSAKLANLWGQQFLLTSIDRRFAATSDARKYLEGRLETLRQNLESSERALINY
IILERLAVSPVRNSSLVDVSFSTPSPKLSAKLANLWGQQ                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GTSKGIVTISSQTDANGRTQSETLVGADIANIGEALAKAREARIAAESELASASIGSAAVNAQTVSSLRERRAELEAQMA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QQRTTFEDDYPAVVQLRAQIADLDRSIARETGRSSQINRDAYAAAVSREKQLQAELDELTQKYNSQQRQSIEMTILQREV


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSNRQLYDGLLQRYKEIGVAGVGTNNISVVDAAEAPSGPSSPNLPLNVVLSLIAGIALASGLIFVLEKMDSSIRDPHDVE


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TRFGLPLLGAIPEVIGQPLADVITDKKSAAYEAYFSLMTNLSFLTAHGAPRSIMLTSSQPKEGKSNSSLCLATVLAASGK
                                                       TSSQPKEGKSNSSLCLATVLAASGK
                                                              GKS               
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SVILVDADIRNPSQNQYLHIPNSLGLSHYLSGDDNLEGMISELPKFGFSIITAGKTPPNAAELLGSDRLDTLVAMLLKRF
SVILVDADIRNPSQNQYLHIPNSLGLSHYLSGDDNLEGMISELPKFGFSIITAGKTPPNAAELLGSDRLDTLVAMLLKRF
  ILVDADIR                                                                      
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DHVLIDSPPLLGLADAPLIARRVEGVLFTIEANSTKRRVIGTALSRLQKSGAKLFGAIVTKVGVKNSAYGYGYGYGYGYS
DHVLIDSPPLLGLADAPLIARRVEGVLFTIEANSTKRRVIGTALSRLQKSGAKLFGAIVTKVGVKNSAYGYGYGYGYGYS
  VLIDSPP                                                           YGYGYGYGYGYS
       730
....:....|
YGDDAKRNDG
YGDDA     
Y         

© 1998-2019