BYKdb

Annotate results for A0A0W1DLQ3

A0A0W1DLQ3 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0W1DLQ3
DOMAINcd70/261TSATPAAGKSYLSLNLASSLARVTEQPVFLVDLDIRRASLAEEIGLVTEQGIESFLEGEV
VDLTQVGVRIEGTQLGLFPAVRRKRNTAELLAGERFAEMIEIFRNRCEAAIILFDLPPAF
ANDDAMISLEHLDGYLLVVDSGRTTRKHVQDVLAMLHPTPCIGSVLNRYEGGFADSYGYG
YGTGHYGKYYEA
SITEWalker A77/79GKS
SITEWalker A'98/105FLVDLDIR
SITEWalker B181/187ILFDLPP
SITEY Cluster246/259YGYGYGTGHYGKYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MADADPTTLNSRDTLRLADLPVFTPEKSRISSHKLVGFDSRDIRARPFNLLRTSLAKKTKEKGFRLVGTTSATPAAGKSY
                                                                     TSATPAAGKSY
                                                                            GKS 
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSLNLASSLARVTEQPVFLVDLDIRRASLAEEIGLVTEQGIESFLEGEVVDLTQVGVRIEGTQLGLFPAVRRKRNTAELL
LSLNLASSLARVTEQPVFLVDLDIRRASLAEEIGLVTEQGIESFLEGEVVDLTQVGVRIEGTQLGLFPAVRRKRNTAELL
                 FLVDLDIR                                                       
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AGERFAEMIEIFRNRCEAAIILFDLPPAFANDDAMISLEHLDGYLLVVDSGRTTRKHVQDVLAMLHPTPCIGSVLNRYEG
AGERFAEMIEIFRNRCEAAIILFDLPPAFANDDAMISLEHLDGYLLVVDSGRTTRKHVQDVLAMLHPTPCIGSVLNRYEG
                    ILFDLPP                                                     
       250       260       270
....:....|....:....|....:....|
GFADSYGYGYGTGHYGKYYEATDDAADGTD
GFADSYGYGYGTGHYGKYYEA         
     YGYGYGTGHYGKYY           
© 1998-2019