BYKdb

Annotate results for A0A0W1GMS6

A0A0W1GMS6 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0W1GMS6
DOMAINcd73/261TSPAPHAGKSFVASNLAASIGQLPNKRTFLIDLDLRRATIARIFGLDVPEGITEFLIGDE
IELRQIGRRIGESNLVVYPTLAAPVNSAELMVSERLDDLVARARALGDDAIVIFDLPPVF
ANDDAILVAEKLDGVLLVIEQGVTTKKQLQGAMQLIHPTPLLGTVFNRFTGGNGDPYGYG
GKYDSYYNS
SITEWalker A80/82GKS
SITEWalker A'101/108FLIDLDLR
SITEWalker B184/190VIFDLPP
SITEY Cluster249/259YGYGGKYDSYY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNSFPNLPQPLGGTPLIAGLPGIGEVPDARDLELSEKLVGFESKDPRSRSFNLLRTQLIKKLAESGGRLVGITSPAPHAG
                                                                        TSPAPHAG
                                                                               G
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KSFVASNLAASIGQLPNKRTFLIDLDLRRATIARIFGLDVPEGITEFLIGDEIELRQIGRRIGESNLVVYPTLAAPVNSA
KSFVASNLAASIGQLPNKRTFLIDLDLRRATIARIFGLDVPEGITEFLIGDEIELRQIGRRIGESNLVVYPTLAAPVNSA
KS                  FLIDLDLR                                                    
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ELMVSERLDDLVARARALGDDAIVIFDLPPVFANDDAILVAEKLDGVLLVIEQGVTTKKQLQGAMQLIHPTPLLGTVFNR
ELMVSERLDDLVARARALGDDAIVIFDLPPVFANDDAILVAEKLDGVLLVIEQGVTTKKQLQGAMQLIHPTPLLGTVFNR
                       VIFDLPP                                                  
       250       260 
....:....|....:....|.
FTGGNGDPYGYGGKYDSYYNS
FTGGNGDPYGYGGKYDSYYNS
        YGYGGKYDSYY  
© 1998-2019