BYKdb

Annotate results for A0A0W1ICB0

A0A0W1ICB0 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0W1ICB0
DOMAINcd481/670TSTSPSEGKSTSAYSLARVIGRTSGSVVLVDVDMRRPVVATRLGLDNSKGVSNFLAGEDN
WEDLIQTIGKSNVSFISAGPVPPSASELLSGDRLASLVRALSERFDHVILDSPPMLGLSD
APLIANVVEGLIYVIEADRTAVRASQAAITRLRESRAHILGALLTKYRARQSGYGYGYGY
GYSYGKDAAA
SITE-549/-551GKS
SITEWalker A'508/515VLVDVDMR
SITEWalker B588/594VILDSPP
SITEY Cluster654/664YGYGYGYGYSY
SITEWalker A488/490GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTPQYTATSRIEIAREQANVTNVEGLKRDSNAPDQEFYLTQYSLLNARSLAERVERRLRLARNPEFFAAHGETPEGEGLL


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SGLRSGPVSAADLRQRERQAVELLLDNVGISPLRGSALVDVSYSSASPQLSRLIASTWVNEFVQQSMDRRLASTADARIY


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LEGRLQGLRDRLEKSERDLVNYAARQGIVRLSEIQGEDGRTRTTQTLASSDLEQLNRLLVQATAERAEAESKLSAARAPG


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
ATQLGLSNQSLSTLRQRRAEANAAYQELLVQFEPEYPQAQAAREKVAALDRAISAEETRVRGAYSADYNAAVQRETDLRA


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
RVDRLLGRLDTENRSSIQYNIYQREVDTNRELYDGLLQRYKEIGVAGVGTNNISVVDDAVNPVKPSSPRLVLNLAAALLL


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
GLLFAGLTVVILENLDESVREPQQISDRLGVPLLGAIPVVDDEVLSDIEDPKSILSEAYMTVRTNLGFSTDHGLPRTMAL


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
TSTSPSEGKSTSAYSLARVIGRTSGSVVLVDVDMRRPVVATRLGLDNSKGVSNFLAGEDNWEDLIQTIGKSNVSFISAGP
TSTSPSEGKSTSAYSLARVIGRTSGSVVLVDVDMRRPVVATRLGLDNSKGVSNFLAGEDNWEDLIQTIGKSNVSFISAGP
       GKS                 VLVDVDMR                                             
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VPPSASELLSGDRLASLVRALSERFDHVILDSPPMLGLSDAPLIANVVEGLIYVIEADRTAVRASQAAITRLRESRAHIL
VPPSASELLSGDRLASLVRALSERFDHVILDSPPMLGLSDAPLIANVVEGLIYVIEADRTAVRASQAAITRLRESRAHIL
                           VILDSPP                                              
       650       660       670     
....:....|....:....|....:....|....:
GALLTKYRARQSGYGYGYGYGYSYGKDAAATDGAN
GALLTKYRARQSGYGYGYGYGYSYGKDAAA     
             YGYGYGYGYSY           
© 1998-2019