BYKdb

Annotate results for A0A0W1JR47

A0A0W1JR47 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0W1JR47
DOMAINcd42/230TSAGPGEGKSSTVANLAVSIAQSGKSVLIIDGDLRNPTQHKIFNVPNTHGLSTTLVEEIH
SLTHSVKTFTEGLELLPAGPIPPNPAELLGSKKMKQLLFDAAKAYDIILIDSPPTIAVTD
SSVLAQSVDGVVLILAAGEVKQEYALRAKEQLEKVGAKIIGTVINKVELKTKEHYYYYYY
HGENRSQSI
SITE-65/-67GKS
SITEWalker A'69/76LIIDGDLR
SITEWalker B149/155ILIDSPP
SITEY Cluster216/221YYYYYY
SITEWalker A49/51GKS
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MRRYSIETLANPKSTVSEAYRTLRTNIQFANVDNVIKKILFTSAGPGEGKSSTVANLAVSIAQSGKSVLIIDGDLRNPTQ
                                         TSAGPGEGKSSTVANLAVSIAQSGKSVLIIDGDLRNPTQ
                                                GKS                 LIIDGDLR    
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
HKIFNVPNTHGLSTTLVEEIHSLTHSVKTFTEGLELLPAGPIPPNPAELLGSKKMKQLLFDAAKAYDIILIDSPPTIAVT
HKIFNVPNTHGLSTTLVEEIHSLTHSVKTFTEGLELLPAGPIPPNPAELLGSKKMKQLLFDAAKAYDIILIDSPPTIAVT
                                                                    ILIDSPP     
       170       180       190       200       210       220       230
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DSSVLAQSVDGVVLILAAGEVKQEYALRAKEQLEKVGAKIIGTVINKVELKTKEHYYYYYYHGENRSQSI
DSSVLAQSVDGVVLILAAGEVKQEYALRAKEQLEKVGAKIIGTVINKVELKTKEHYYYYYYHGENRSQSI
                                                       YYYYYY         
© 1998-2019