BYKdb

Annotate results for A0A0W1KSY0

A0A0W1KSY0 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0W1KSY0
DOMAINtad12/199DIIDLGVYFNVIKRAKWRILAFSIVVTLLAIMATFTLVPKYIATATLLIEAEQAKAVSFE
EIYGLDSNKKEYYLTQFEVMKSDSIAREVITKLDLKTHPDFIGKPSVLNQLKSMVKNKLK
EHIPSLNKKEIIVYSPEDQSEREMLNLLGAFKSRLYVTPIRNTQLVRISFQSSDPKLAAL
VANTVGQV
DOMAINcd544/735TSSSPGEGKTTTSANLAMSLAQMGKVLLIDADLRKPSIAKRFDIPVFHPGLSNLIVGTEQ
LPECVHIDGQSGVAVMPSGQIPGNPLELLSSTQFSEVLDILKEKYDHIVIDTPPTQAVSD
ALVVAQNADSVIYVVKSDVTRIKLIKAGVERLFESKAHVAGIVLNQVDMNKRKDEHSHGY
YDYHDYSQKPEQ
SITEWalker A551/553GKT
SITEWalker A'570/577LLIDADLR
SITEWalker B651/657IVIDTPP
SITEY Cluster723/729YYDYHDY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MHHTNEKINSEDIIDLGVYFNVIKRAKWRILAFSIVVTLLAIMATFTLVPKYIATATLLIEAEQAKAVSFEEIYGLDSNK
           DIIDLGVYFNVIKRAKWRILAFSIVVTLLAIMATFTLVPKYIATATLLIEAEQAKAVSFEEIYGLDSNK

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
KEYYLTQFEVMKSDSIAREVITKLDLKTHPDFIGKPSVLNQLKSMVKNKLKEHIPSLNKKEIIVYSPEDQSEREMLNLLG
KEYYLTQFEVMKSDSIAREVITKLDLKTHPDFIGKPSVLNQLKSMVKNKLKEHIPSLNKKEIIVYSPEDQSEREMLNLLG

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
AFKSRLYVTPIRNTQLVRISFQSSDPKLAALVANTVGQVYIESQMRAKMGITQQASSWLNTRLSQLRIQLDDSEVRLQAY
AFKSRLYVTPIRNTQLVRISFQSSDPKLAALVANTVGQV                                         

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
REQQKLVDIEGIAGLATQELEQISQQLIVARNEQNNLQSINRVISEYGNNNLELLGSMPEITSHQVIQNVKRDVIVVERK


       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LSELGEVYGPKHPKIISAKAELKTVKDNLNKQIKGLITGIEKELNRITRTVSALERDLVKIRAEYQEITRKETQYNQLKR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EVETNRNIFNTFLSRSKETEVTSDFSSAAARFTDQAYAPNSPSKPNKKLIIILAFVVSFGFAAVMSFVFDALNDTVKTKS


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DVESKLAQRMLGLLPYVKIPRKSHFPIHAYLDDNFRRFAESVRTFRTSLLLTQLDREHKVIAITSSSPGEGKTTTSANLA
                                                               TSSSPGEGKTTTSANLA
                                                                      GKT       
       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MSLAQMGKVLLIDADLRKPSIAKRFDIPVFHPGLSNLIVGTEQLPECVHIDGQSGVAVMPSGQIPGNPLELLSSTQFSEV
MSLAQMGKVLLIDADLRKPSIAKRFDIPVFHPGLSNLIVGTEQLPECVHIDGQSGVAVMPSGQIPGNPLELLSSTQFSEV
         LLIDADLR                                                               
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LDILKEKYDHIVIDTPPTQAVSDALVVAQNADSVIYVVKSDVTRIKLIKAGVERLFESKAHVAGIVLNQVDMNKRKDEHS
LDILKEKYDHIVIDTPPTQAVSDALVVAQNADSVIYVVKSDVTRIKLIKAGVERLFESKAHVAGIVLNQVDMNKRKDEHS
          IVIDTPP                                                               
       730        
....:....|....:...
HGYYDYHDYSQKPEQSNS
HGYYDYHDYSQKPEQ   
  YYDYHDY         

© 1998-2019