BYKdb

Annotate results for A0A0W1L7P3

A0A0W1L7P3 is a bacterial tyrosine kinase (cluster tadcd).

AccessionAnnotations
A0A0W1L7P3
DOMAINtad23/278QEIDLMALLGALLDRKFFIVALTALFMFIGVVYAVLSTPIYQATAMIQVEESGGSVPGFD
DMAGMFESTSAAVTEIELLKSRSIIGEAVDTLKLDITVEPKLYPFIGGRAFRKFTPMNEG
DLAEPSFGATSYAWGGESVDVFRFDVPKSAVGVEFTLVAQENNSVALVSDDGEQILAGKV
GQELTNGKFSLTIRSINARAGSEFIITRKDRLNTILDLQASIGASEKGKDSGIINLSLQS
AIPSYAEKVLDKVAAI
DOMAINcd558/746SGPSPGVGKSFISVNLASVLAQSGKKVLIIDADMRKGYLQTQFGIKWDNGLSDYLSGRLN
LAQVTKPTQVEGLSVITRGQIPPNPSELLMHSNFSKLVEEVSAEYDLVIIDTPPILAVTD
PAIVSAHTGTTLLVTRFGQNHIKEIELTRARFEQNGTDVKGVVFNGVVKKASNAYGYYGY
YNYEYKSDK
SITEWalker A565/567GKS
SITEWalker A'585/592LIIDADMR
SITEWalker B665/671VIIDTPP
SITEY Cluster732/742YGYYGYYNYEY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MNAQPTAIAANKQNRTNEQSPSQEIDLMALLGALLDRKFFIVALTALFMFIGVVYAVLSTPIYQATAMIQVEESGGSVPG
                      QEIDLMALLGALLDRKFFIVALTALFMFIGVVYAVLSTPIYQATAMIQVEESGGSVPG

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
FDDMAGMFESTSAAVTEIELLKSRSIIGEAVDTLKLDITVEPKLYPFIGGRAFRKFTPMNEGDLAEPSFGATSYAWGGES
FDDMAGMFESTSAAVTEIELLKSRSIIGEAVDTLKLDITVEPKLYPFIGGRAFRKFTPMNEGDLAEPSFGATSYAWGGES

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
VDVFRFDVPKSAVGVEFTLVAQENNSVALVSDDGEQILAGKVGQELTNGKFSLTIRSINARAGSEFIITRKDRLNTILDL
VDVFRFDVPKSAVGVEFTLVAQENNSVALVSDDGEQILAGKVGQELTNGKFSLTIRSINARAGSEFIITRKDRLNTILDL

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QASIGASEKGKDSGIINLSLQSAIPSYAEKVLDKVAAIYVRRNVERNSAEAKKSLDFLEVQLPEIKKQLEYAEERFNEYQ
QASIGASEKGKDSGIINLSLQSAIPSYAEKVLDKVAAI                                          

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
IKRQSINITLETQGVLEQVVELETKLQELELKRLEMSRKFKESHPTYQGVLEQIEAVEKQKQRLVGEVGNLPETQQELLR


       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
LKRDVEVSNEIYTLLLAKTQELDIVRAGTVGNVRIIDYAEVNTSKPVKPKKALIVIMATMLGGMLAVAIVLVQKAMHKGV


       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EDANEIEAIGLPVYASVPYSDYQDKLTGFSKARKAKSKPKSILALDNPADLSIEALRSLRTSLHFAMMEAKNNLIAISGP
                                                                             SGP

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
SPGVGKSFISVNLASVLAQSGKKVLIIDADMRKGYLQTQFGIKWDNGLSDYLSGRLNLAQVTKPTQVEGLSVITRGQIPP
SPGVGKSFISVNLASVLAQSGKKVLIIDADMRKGYLQTQFGIKWDNGLSDYLSGRLNLAQVTKPTQVEGLSVITRGQIPP
    GKS                 LIIDADMR                                                
       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
NPSELLMHSNFSKLVEEVSAEYDLVIIDTPPILAVTDPAIVSAHTGTTLLVTRFGQNHIKEIELTRARFEQNGTDVKGVV
NPSELLMHSNFSKLVEEVSAEYDLVIIDTPPILAVTDPAIVSAHTGTTLLVTRFGQNHIKEIELTRARFEQNGTDVKGVV
                        VIIDTPP                                                 
       730       740      
....:....|....:....|....:.
FNGVVKKASNAYGYYGYYNYEYKSDK
FNGVVKKASNAYGYYGYYNYEYKSDK
           YGYYGYYNYEY    

© 1998-2019