BYKdb

Annotate results for A0A0W7TNU4

A0A0W7TNU4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0W7TNU4
DOMAINcd50/240TSAIPGEGKSSVALNLAVSLAETGSRVLVIDCDLRKPIIHRYLKIDNSAYKGIISALADG
SLAESIINMKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIFDTPPVSVVT
DAAVLSQYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYY
YSYNYSYENAD
SITEWalker A57/59GKS
SITEWalker A'77/84LVIDCDLR
SITEWalker B158/164IIFDTPP
SITE-155/-157YEY
SITEY Cluster228/236YYYSYNYSY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MMAKKSKPIRREFVLMNKNTSFQYQEAYKSLRTNLNFMAMGKACKKLIFTSAIPGEGKSSVALNLAVSLAETGSRVLVID
                                                 TSAIPGEGKSSVALNLAVSLAETGSRVLVID
                                                        GKS                 LVID
        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CDLRKPIIHRYLKIDNSAYKGIISALADGSLAESIINMKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIF
CDLRKPIIHRYLKIDNSAYKGIISALADGSLAESIINMKGLGLHVMVADAIPPNPVELLGSPRMKNLIDELDKHYEYIIF
CDLR                                                                         IIF
       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
DTPPVSVVTDAAVLSQYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYYYSYNYSYENAD
DTPPVSVVTDAAVLSQYADGVILVVRQNYATFDEVGLAKKNLDAVNANILGAVLNGFDTKSTEKKNGYYYSYNYSYENAD
DTPP                                                               YYYSYNYSY    
 
.
R


© 1998-2019