BYKdb

Annotate results for A0A0W7WHP4

A0A0W7WHP4 is a bacterial tyrosine kinase (cluster orphancd).

AccessionAnnotations
A0A0W7WHP4
DOMAINcd315/499TSPGKDCGKTFTAANLAISLSRQENCRTLLLDCDMRRPSLHSVMGVEAPGAIGDLLRGTV
APEEHLLRPGPNDIHAGRNIAFGFNDMTEPYASELLQDPRTRGMLDLIETQMQPDVMLFD
LPPALFYDDVIAFRPLFDGVLLVVGGGLTTQKEIKEVERRLGDSTPLLGMVLNKAEHTEI
SRYRY
SITEWalker A322/324GKT
SITEWalker A'343/350LLLDCDMR
SITEWalker B431/437MLFDLPP
SITEY Cluster497/499YRY
        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTDQRKFRRKGKRVRDAAPTETDMTPVPPLEPRARRSEDTLPETGGTSARETEEAREAEEARAAETQRATEEQAKRDAEA


        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
QRAADAKRAADAKRAAEEQARREAEEQARREAAEHARREEQAQREAQAQRAAEEQAHREAEEQREARARSAAAVEALRRA


       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
EAERQAAAARKAELEERAAEEARLAEEARLKELDARRRALAEARSIAARRGADPDGPAAPPRPDPERQPAPQSSRPGRPP


       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
PLALTNPAERAERVEAATRAAWARLDSFALDAGHLNRNRIITARRDDPAHAAFDVLRTRLLQALHEHGWKRVAITSPGKD
                                                                          TSPGKD

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
CGKTFTAANLAISLSRQENCRTLLLDCDMRRPSLHSVMGVEAPGAIGDLLRGTVAPEEHLLRPGPNDIHAGRNIAFGFND
CGKTFTAANLAISLSRQENCRTLLLDCDMRRPSLHSVMGVEAPGAIGDLLRGTVAPEEHLLRPGPNDIHAGRNIAFGFND
 GKT                  LLLDCDMR                                                  
       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
MTEPYASELLQDPRTRGMLDLIETQMQPDVMLFDLPPALFYDDVIAFRPLFDGVLLVVGGGLTTQKEIKEVERRLGDSTP
MTEPYASELLQDPRTRGMLDLIETQMQPDVMLFDLPPALFYDDVIAFRPLFDGVLLVVGGGLTTQKEIKEVERRLGDSTP
                              MLFDLPP                                           
       490         
....:....|....:....
LLGMVLNKAEHTEISRYRY
LLGMVLNKAEHTEISRYRY
                YRY
© 1998-2019